Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G28740 141 / 5e-39 CYP81D11, CYP81D1 cytochrome P450, family 81, subfamily D, polypeptide 11, Cytochrome P450 superfamily protein (.1) AT2G23220 141 / 5e-39 CYP81D6 "cytochrome P450, family 81, subfamily D, polypeptide 6", cytochrome P450, family 81, subfamily D, polypeptide 6 (.1) AT2G23190 139 / 8e-38 CYP81D7 "cytochrome P450, family 81, subfamily D, polypeptide 7", cytochrome P450, family 81, subfamily D, polypeptide 7 (.1) AT4G37370 136 / 3e-37 CYP81D8 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) AT4G37320 136 / 4e-37 CYP81D5 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) AT4G37330 131 / 2e-35 CYP81D4 "cytochrome P450, family 81, subfamily D, polypeptide 4", cytochrome P450, family 81, subfamily D, polypeptide 4 (.1) AT4G37340 129 / 2e-34 CYP81D3 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) AT4G37310 127 / 6e-34 CYP81H1 "cytochrome P450, family 81, subfamily H, polypeptide 1", cytochrome P450, family 81, subfamily H, polypeptide 1 (.1) AT5G36220 126 / 2e-33 CYP91A1, CYP81D1 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) AT4G37430 124 / 8e-33 CYP81F1, CYP91A2 "cytochrome P450, family 91, subfamily A, polypeptide 2", CYTOCHROME P450 MONOOXYGENASE 81F1, cytochrome P450, family 91, subfamily A, polypeptide 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032857 [exp] 147 / 2e-42 AT4G37370 225 / 8e-70 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10020437 [exp] 148 / 1e-41 AT4G37370 630 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10018711 [exp] 148 / 2e-41 AT4G37370 441 / 5e-151 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10024820 [exp] 144 / 6e-40 AT5G36220 493 / 2e-171 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) Lus10024819 [exp] 140 / 1e-38 AT4G37320 493 / 3e-171 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10024818 [exp] 139 / 5e-38 AT4G37320 480 / 2e-166 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10011958 [exp] 133 / 6e-36 AT5G36220 548 / 0.0 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) Lus10018717 [exp] 125 / 8e-33 AT4G37370 533 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10041643 [exp] 121 / 2e-31 AT4G37320 433 / 6e-148 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G121300 [exp] 198 / 8e-62 AT4G37370 308 / 2e-101 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020500 [exp] 184 / 5e-55 AT4G37370 462 / 2e-159 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121400 [exp] 177 / 2e-52 AT4G37370 470 / 1e-162 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121200 [exp] 173 / 5e-51 AT4G37340 465 / 1e-160 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) Potri.002G121100 [exp] 168 / 4e-49 AT4G37370 429 / 2e-146 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020600 [exp] 164 / 1e-47 AT4G37370 479 / 4e-166 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020432 [exp] 162 / 8e-47 AT4G37370 440 / 4e-151 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020700 [exp] 158 / 2e-46 AT4G37320 279 / 4e-90 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Potri.003G008200 [exp] 149 / 6e-42 AT4G37370 531 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G021800 [exp] 147 / 3e-41 AT4G37360 458 / 1e-157 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10018713 pacid=23176273 polypeptide=Lus10018713 locus=Lus10018713.g ID=Lus10018713.BGIv1.0 annot-version=v1.0 ATGTACACCATGGAAATTCCATATCTCATCTACTTCATCCTGTTCTTACTCTCTTATCCTCTTGCCAAATACTTGTTAAGCAAAAAAGCAGTACTCCACC TCCCGCCATCCCCTGCCACCCCTCTCCCAATCATAGGCCACCTCCACCTCCTCAAAACGCCTCTCCACACAACCCTCGCAGACCTCTCCGCCAAGTACGG CGCCGTCTTGTCCCTCCATTTCGGCTCCCGCCCCGTGCTCCACGTGTCCTCCCCTTCCGCCGCCGAAGAATGCTTCACCACCAACGACGTCGTCTTCGCC AACCGCCCCAACCTCCTCGCCGGCAAACACCTCGGCTACAACTACACCGCTCTCGTCTGGGCCCCCTACGGTCAGCATTGGCGCAATCTCCGGCGCGTGG CAACAATCGAGATGCTTTCTTCCACCCGGATCCATATGCTGCAACGGATTCGGGTCGAAGAGGTCCGGACTCTGCTTCGGAGGCTGTTCGACTGCGGCAG CAGCGGGGAATTCCGCACCGTTGATATGAAATCCGTGTTTTTTGAGCTTAGCCTGAATGTTCTGATTAGGATGATCGCCGGGAAGAGGTACTACGGCGGC AGCCAAGGGGAACTGCGGCAGCCAAGAGGAACTGGAGGAGGCGGCGAGGTTCAAGGAAATTGTGAGGGAGACGTTCGAGCTGAGCGGTGCTACGAATATT GGGGATTTTGTGCCGATGCTGAGGTGGTTTGGGTTGAATAA
AA sequence Show only first row Show all	>Lus10018713 pacid=23176273 polypeptide=Lus10018713 locus=Lus10018713.g ID=Lus10018713.BGIv1.0 annot-version=v1.0 MYTMEIPYLIYFILFLLSYPLAKYLLSKKAVLHLPPSPATPLPIIGHLHLLKTPLHTTLADLSAKYGAVLSLHFGSRPVLHVSSPSAAEECFTTNDVVFA NRPNLLAGKHLGYNYTALVWAPYGQHWRNLRRVATIEMLSSTRIHMLQRIRVEEVRTLLRRLFDCGSSGEFRTVDMKSVFFELSLNVLIRMIAGKRYYGG SQGELRQPRGTGGGGEVQGNCEGDVRAERCYEYWGFCADAEVVWVE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G23190		CYP81D7	"cytochrome P450, family 81, s...		Lus10018713 [exp]	0	1
AT4G37340		CYP81D3	"cytochrome P450, family 81, s...		Lus10018712 [exp]	1.0	0.7623
AT1G60970			SNARE-like superfamily protein...		Lus10025383 [exp]	14.6	0.7306
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10042693 [exp]	22.6	0.6403
AT3G18590		AtENODL5	early nodulin-like protein 5 (...		Lus10009617 [exp]	24.1	0.7023
AT1G19670		CORI1, ATHCOR1,...	CORONATINE-INDUCED PROTEIN 1, ...		Lus10004076 [exp]	32.9	0.6878
AT5G21430		NdhU, CRRL	NADH dehydrogenase-like comple...		Lus10011955 [exp]	33.1	0.6551
AT5G37820		NIP4;2, NLM5	NODULIN- 26-LIKE MAJOR INTRINS...		Lus10025744 [exp]	35.9	0.6568
AT4G15550		IAGLU	indole-3-acetate beta-D-glucos...		Lus10027584 [exp]	37.5	0.6824
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10025104 [exp]	38.9	0.6821
AT1G49230			RING/U-box superfamily protein...		Lus10006786 [exp]	41.4	0.6517

Compare expression of checked genes

Lus10018713 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.