Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36220 87 / 3e-21 CYP91A1, CYP81D1 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) AT4G37310 82 / 1e-19 CYP81H1 "cytochrome P450, family 81, subfamily H, polypeptide 1", cytochrome P450, family 81, subfamily H, polypeptide 1 (.1) AT4G37370 81 / 3e-19 CYP81D8 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) AT2G23190 78 / 3e-18 CYP81D7 "cytochrome P450, family 81, subfamily D, polypeptide 7", cytochrome P450, family 81, subfamily D, polypeptide 7 (.1) AT4G37330 77 / 6e-18 CYP81D4 "cytochrome P450, family 81, subfamily D, polypeptide 4", cytochrome P450, family 81, subfamily D, polypeptide 4 (.1) AT1G66540 77 / 9e-18 Cytochrome P450 superfamily protein (.1.2) AT2G23220 76 / 2e-17 CYP81D6 "cytochrome P450, family 81, subfamily D, polypeptide 6", cytochrome P450, family 81, subfamily D, polypeptide 6 (.1) AT3G28740 76 / 3e-17 CYP81D11, CYP81D1 cytochrome P450, family 81, subfamily D, polypeptide 11, Cytochrome P450 superfamily protein (.1) AT4G37320 72 / 7e-16 CYP81D5 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) AT4G37360 71 / 1e-15 CYP81D2 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024816 [exp] 129 / 3e-36 AT4G37370 506 / 2e-176 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10018717 [exp] 97 / 7e-25 AT4G37370 533 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10024818 [exp] 88 / 1e-21 AT4G37320 480 / 2e-166 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10024819 [exp] 87 / 2e-21 AT4G37320 493 / 3e-171 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10018713 [exp] 81 / 5e-20 AT2G23190 185 / 3e-55 "cytochrome P450, family 81, subfamily D, polypeptide 7", cytochrome P450, family 81, subfamily D, polypeptide 7 (.1) Lus10024820 [exp] 83 / 8e-20 AT5G36220 493 / 2e-171 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) Lus10011958 [exp] 76 / 4e-17 AT5G36220 548 / 0.0 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) Lus10010373 [exp] 75 / 4e-17 AT4G37370 375 / 3e-126 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10027614 [exp] 73 / 3e-16 AT4G37370 496 / 6e-174 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G021800 [exp] 85 / 1e-20 AT4G37360 458 / 1e-157 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1) Potri.005G144000 [exp] 83 / 9e-20 AT5G36220 496 / 6e-173 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) Potri.003G006000 [exp] 82 / 2e-19 AT4G37370 526 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.007G049900 [exp] 82 / 2e-19 AT4G37370 490 / 1e-170 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.005G143800 [exp] 81 / 4e-19 AT4G37370 539 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.005G143900 [exp] 77 / 1e-17 AT4G37370 511 / 5e-179 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121300 [exp] 75 / 4e-17 AT4G37370 308 / 2e-101 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020432 [exp] 75 / 5e-17 AT4G37370 440 / 4e-151 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020600 [exp] 75 / 6e-17 AT4G37370 479 / 4e-166 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.003G007000 [exp] 75 / 6e-17 AT4G37370 525 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018718 pacid=23176297 polypeptide=Lus10018718 locus=Lus10018718.g ID=Lus10018718.BGIv1.0 annot-version=v1.0 ATGGTAGCCTCCCCGTACGGCGAACACTGGCGTAACCTCCGCTGCCTCTCCACCATCGAGCTACTCTCCACCTCTCGCCTCAACTCCTTCATCCGCCCCC GTCACGAGGAAGTCAGGGTCCTGGTCAGCGATCTTTTCAGAAACGTCGCTGTTTCAGGGTCCGGCAGGTCAGGGGGTAAGGTGGAGATGAAATCGAGGCT GTTGGGGTTGTCGATGAATATTATAATGAGGATGGTTGTCGGGAAGAGATATTTCGGGATGGCAGAAGTGGAAGAGGACGCGGAGGAAAGCGAGAGGTTA AGGAGTTGA
AA sequence Show only first row Show all	>Lus10018718 pacid=23176297 polypeptide=Lus10018718 locus=Lus10018718.g ID=Lus10018718.BGIv1.0 annot-version=v1.0 MVASPYGEHWRNLRCLSTIELLSTSRLNSFIRPRHEEVRVLVSDLFRNVAVSGSGRSGGKVEMKSRLLGLSMNIIMRMVVGKRYFGMAEVEEDAEESERL RS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G36220		CYP91A1, CYP81D...	CYTOCHROME P450 91A1, cytochro...		Lus10018718 [exp]	0	1
AT1G16930			F-box/RNI-like/FBD-like domain...		Lus10023036 [exp]	1.0	1.0000
AT1G06340			Plant Tudor-like protein (.1)		Lus10039027 [exp]	1.4	1.0000
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Lus10026169 [exp]	3.0	1.0000
AT2G44220			Protein of Unknown Function (D...		Lus10006862 [exp]	3.5	1.0000
					Lus10011438 [exp]	4.5	0.8093
AT3G60680			Plant protein of unknown funct...		Lus10034935 [exp]	4.6	0.8332
AT4G26466		LRE	lorelei (.1)		Lus10011066 [exp]	5.0	0.9188
AT5G28823			unknown protein		Lus10040056 [exp]	5.5	0.8646
AT4G25950		VATG3	vacuolar ATP synthase G3 (.1)		Lus10009452 [exp]	6.0	0.8222
AT5G25940			early nodulin-related (.1)		Lus10043290 [exp]	6.2	0.7493

Compare expression of checked genes

Lus10018718 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.