Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37360 179 / 3e-54 CYP81D2 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1) AT1G66540 173 / 2e-53 Cytochrome P450 superfamily protein (.1.2) AT5G36220 169 / 4e-50 CYP91A1, CYP81D1 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) AT4G37340 167 / 2e-49 CYP81D3 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) AT5G67310 165 / 9e-49 CYP81G1 "cytochrome P450, family 81, subfamily G, polypeptide 1", cytochrome P450, family 81, subfamily G, polypeptide 1 (.1) AT4G37370 164 / 2e-48 CYP81D8 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) AT4G37330 162 / 1e-47 CYP81D4 "cytochrome P450, family 81, subfamily D, polypeptide 4", cytochrome P450, family 81, subfamily D, polypeptide 4 (.1) AT4G37320 154 / 1e-44 CYP81D5 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) AT4G37310 152 / 1e-43 CYP81H1 "cytochrome P450, family 81, subfamily H, polypeptide 1", cytochrome P450, family 81, subfamily H, polypeptide 1 (.1) AT3G28740 150 / 3e-43 CYP81D11, CYP81D1 cytochrome P450, family 81, subfamily D, polypeptide 11, Cytochrome P450 superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024816 [exp] 302 / 2e-101 AT4G37370 506 / 2e-176 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10024817 [exp] 227 / 7e-76 AT4G37330 209 / 2e-65 "cytochrome P450, family 81, subfamily D, polypeptide 4", cytochrome P450, family 81, subfamily D, polypeptide 4 (.1) Lus10018717 [exp] 211 / 5e-66 AT4G37370 533 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10020437 [exp] 179 / 3e-54 AT4G37370 630 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10010373 [exp] 173 / 3e-52 AT4G37370 375 / 3e-126 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10018712 [exp] 158 / 3e-48 AT4G37340 279 / 8e-94 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) Lus10027614 [exp] 155 / 2e-45 AT4G37370 496 / 6e-174 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10011958 [exp] 153 / 3e-44 AT5G36220 548 / 0.0 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) Lus10018711 [exp] 142 / 4e-40 AT4G37370 441 / 5e-151 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G007000 [exp] 167 / 2e-49 AT4G37370 525 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.003G008200 [exp] 165 / 1e-48 AT4G37370 531 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.003G007900 [exp] 165 / 2e-48 AT4G37370 524 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.003G006000 [exp] 164 / 3e-48 AT4G37370 526 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.007G050000 [exp] 162 / 1e-47 AT4G37370 509 / 3e-178 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121200 [exp] 159 / 1e-46 AT4G37340 465 / 1e-160 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) Potri.014G020600 [exp] 158 / 4e-46 AT4G37370 479 / 4e-166 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121400 [exp] 157 / 8e-46 AT4G37370 470 / 1e-162 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020500 [exp] 151 / 2e-43 AT4G37370 462 / 2e-159 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121100 [exp] 150 / 5e-43 AT4G37370 429 / 2e-146 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10018719 pacid=23176263 polypeptide=Lus10018719 locus=Lus10018719.g ID=Lus10018719.BGIv1.0 annot-version=v1.0 ATGTGGAAAGTTCAGGCGAAGTCCGATGCTTTGTTCCAAGGCTTGATCGATGAGCATAAAACGAAACGGCGGGATGGCGACGTTGTTACGAATCCTGATG GTAGAAAGACGATGATAAATACGATGTTGTCCATGCAAGAATCTGATCCTGAAATTTACACCGACGACATCATCAAAGGCCATCTCATGGTGGCTGCACC GATTCTAGTGCCGCACCAATCGTCAGAGGATTGCGCCATCGGGGGCTATCCCATTTTGAAAGGCACGATGTTAATGGTCAATGCGTGGGCTATTCACAGG GACCCTGCAACTTGGGATGATCCTACAAGTTTCAAGCCCGAGAGACATGAAGCTGGAGTGGTGAAGGTTGAGGGTGGTTGCAAGTTTTTGCCATGTGGGA TGGGAAGAAGGTCGTGCCCTGGATCGGGGCTCGCGACTAGGGTGGTTAGCCTCGCGCTGGGTGCGTTGATTCAGTGTTTCGAGTGGGAAAGAGATGGTGA AGAGCTGCTGGATATGACCGAAGGGCAGGGGCTAACTATGCCCAAGCTTGTGCCTTTGGAGGTTCTTGTGTAA
AA sequence Show only first row Show all	>Lus10018719 pacid=23176263 polypeptide=Lus10018719 locus=Lus10018719.g ID=Lus10018719.BGIv1.0 annot-version=v1.0 MWKVQAKSDALFQGLIDEHKTKRRDGDVVTNPDGRKTMINTMLSMQESDPEIYTDDIIKGHLMVAAPILVPHQSSEDCAIGGYPILKGTMLMVNAWAIHR DPATWDDPTSFKPERHEAGVVKVEGGCKFLPCGMGRRSCPGSGLATRVVSLALGALIQCFEWERDGEELLDMTEGQGLTMPKLVPLEVLV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37360		CYP81D2	"cytochrome P450, family 81, s...		Lus10018719 [exp]	0	1
AT3G02210		COBL1	COBRA-like protein 1 precursor...		Lus10034379 [exp]	1.7	0.8035
AT5G15280			Pentatricopeptide repeat (PPR)...		Lus10015374 [exp]	2.0	0.8072
AT1G30920			F-box family protein (.1)		Lus10006734 [exp]	4.4	0.8571
AT1G17020		ATSRG1, SRG1	senescence-related gene 1 (.1)		Lus10004582 [exp]	8.7	0.7418
					Lus10029164 [exp]	8.9	0.7591
AT3G08030			Protein of unknown function, D...		Lus10029502 [exp]	11.8	0.7441
AT1G30700			FAD-binding Berberine family p...		Lus10031080 [exp]	13.0	0.7441
AT2G24370			Protein kinase protein with ad...		Lus10027593 [exp]	14.0	0.7441
AT3G18170			Glycosyltransferase family 61 ...		Lus10032454 [exp]	15.0	0.7441
AT2G26490			Transducin/WD40 repeat-like su...		Lus10032868 [exp]	15.9	0.7441

Compare expression of checked genes

Lus10018719 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.