Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G02210 58 / 4e-11 unknown protein AT2G24960 42 / 2e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023062 [exp] 227 / 6e-76 AT4G02210 67 / 4e-12 unknown protein Lus10011599 [exp] 219 / 6e-76 AT4G02210 54 / 1e-09 unknown protein Lus10032996 [exp] 198 / 1e-64 AT4G02210 49 / 2e-06 unknown protein Lus10034954 [exp] 92 / 4e-24 ND / Lus10036046 [exp] 91 / 2e-22 AT1G33811 188 / 1e-55 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10006034 [exp] 76 / 2e-17 AT5G27260 42 / 2e-04 unknown protein Lus10018174 [exp] 75 / 4e-17 AT5G41980 68 / 1e-12 unknown protein Lus10010798 [exp] 74 / 1e-16 AT5G27260 61 / 5e-10 unknown protein Lus10032874 [exp] 72 / 5e-16 AT5G27260 53 / 1e-07 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G200600 [exp] 44 / 4e-06 AT4G02210 471 / 1e-163 unknown protein Potri.006G265900 [exp] 44 / 7e-06 AT2G24960 761 / 0.0 unknown protein Potri.006G191850 [exp] 42 / 1e-05 AT4G02550 71 / 2e-15 unknown protein Potri.004G172900 [exp] 41 / 4e-05 AT2G24960 96 / 1e-21 unknown protein Potri.010G215600 [exp] 40 / 0.0001 AT4G02550 77 / 7e-16 unknown protein Potri.013G025200 [exp] 39 / 0.0004 AT2G24960 514 / 2e-168 unknown protein Potri.011G163248 [exp] 39 / 0.0004 AT4G02550 93 / 4e-22 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018740 pacid=23176175 polypeptide=Lus10018740 locus=Lus10018740.g ID=Lus10018740.BGIv1.0 annot-version=v1.0 ATGTCGCGGAAATACCTGACATGGTCCCCCCAAGAAGATCAAGTGCTGTTTGACATTCTGCTAAGCTTGCATGATTCTGGCGACATCCAAAATGGGACCC TAAAGGGATGTGGCTATAATCAAGTGCATAAGAGGTTGAAGCAAATCCTCCCTGACACCAAGCATGATTCGGAATCAATAAAGACCAAGTTTCGTGCCTA CAAAACCAAGTTCAATGCTCAGGTTGAAATAATGAATGCATCTGGCCTAGGTTGGGATGATGAGAGGGGGTGTTGTACTTGTGACAAGGAGGTTTGGGTG GAATGGGTTAAGGCAACTGAGCCAGTGCCATCTGAATAG
AA sequence Show only first row Show all	>Lus10018740 pacid=23176175 polypeptide=Lus10018740 locus=Lus10018740.g ID=Lus10018740.BGIv1.0 annot-version=v1.0 MSRKYLTWSPQEDQVLFDILLSLHDSGDIQNGTLKGCGYNQVHKRLKQILPDTKHDSESIKTKFRAYKTKFNAQVEIMNASGLGWDDERGCCTCDKEVWV EWVKATEPVPSE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G02210			unknown protein		Lus10018740 [exp]	0	1

Compare expression of checked genes

Lus10018740 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.