Lus10018742 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024827 273 / 9e-96 ND 40 / 3e-04
Lus10024825 121 / 7e-36 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G024000 42 / 7e-05 AT4G23180 489 / 4e-165 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G023700 41 / 0.0001 AT4G05200 474 / 3e-159 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10018742 pacid=23176169 polypeptide=Lus10018742 locus=Lus10018742.g ID=Lus10018742.BGIv1.0 annot-version=v1.0
ATGGCTTATAACTCTTGCAAATTAGCGATCCTCATATTCGTCACCGCCGGCGTGATTCTGCCGCGGGGAACTGCATATGACGGCGACTTTAAGTACTTCG
GATGCAACGAGAAGTCGGACAAGATTCCGGCAGGCGGCGGCTACGCCAGCGACATAAAGGAAGCTCTGGCCAAAGTGACGGAGTGCACGAAGCCAGGTGT
GTGGGACGGGAGCTGCAAAATCAAAGTTCCTGATGACTCGGAGCAAGCCAGAGTGTTTGGACATGGGCAGTGCAAGGGTAATGGCGGGATTTCACTGAGG
CTGCCGGTGGAAATGGCGATCGAGAGTGAGTGCACGGATTGTTTAAAGGCTGCCGCTGGCTACCTTCTTTCCAACTGTAATTATACAGAGGCTGATGTTG
TTTATGATCTATGTTCTATGAGCTACAGCTACAGAGACCTTTGA
AA sequence
>Lus10018742 pacid=23176169 polypeptide=Lus10018742 locus=Lus10018742.g ID=Lus10018742.BGIv1.0 annot-version=v1.0
MAYNSCKLAILIFVTAGVILPRGTAYDGDFKYFGCNEKSDKIPAGGGYASDIKEALAKVTECTKPGVWDGSCKIKVPDDSEQARVFGHGQCKGNGGISLR
LPVEMAIESECTDCLKAAAGYLLSNCNYTEADVVYDLCSMSYSYRDL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10018742 0 1
AT1G33800 Protein of unknown function (D... Lus10034373 1.0 0.9845
AT1G76250 unknown protein Lus10012274 2.8 0.9727
AT2G38010 Neutral/alkaline non-lysosomal... Lus10021122 5.8 0.9352
AT1G23460 Pectin lyase-like superfamily ... Lus10030602 7.5 0.9702
AT1G43790 TED6 tracheary element differentiat... Lus10018925 8.3 0.9718
AT1G70500 Pectin lyase-like superfamily ... Lus10030888 8.8 0.9688
AT2G23810 TET8 tetraspanin8 (.1) Lus10018792 8.9 0.9302
AT3G62160 HXXXD-type acyl-transferase fa... Lus10004527 11.2 0.9702
AT4G20040 Pectin lyase-like superfamily ... Lus10036230 13.0 0.9020
AT3G13650 Disease resistance-responsive ... Lus10039561 13.2 0.9671

Lus10018742 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.