Lus10018751 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024837 83 / 2e-19 AT1G03055 229 / 1e-73 unknown protein
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10018751 pacid=23176218 polypeptide=Lus10018751 locus=Lus10018751.g ID=Lus10018751.BGIv1.0 annot-version=v1.0
ATGGTAGAGATCAATGCCGCTTTGTTCCTCCCCGAGTCAGAATCGTCATTTGACTGGCATTACGATCGGACAACTTTCCGCTCCGGTTGCATTGCCACAA
ACTTCTGTTTGCTTCACTCCGATTGCGAACTTCAATGGCGGCAACTGATAGAATCGAAGTCCGAGTTTGGAAGGAGCGTCGACATTCCAGTCCTACTTCC
TCGATCTCTAGCCGCATTCAATCGTATCCTTTCTGATAACTTCGCTGAAGAGAAAGAACTGAGGCTTGTACGGATGAACAATAACGAGAATGTGCGAATT
TATTATCTAAGGAGTTCAGTGTTTCTCACGAGCAGTTTGAAGGAGGAGGATTGCGTGTTTCATTCGAATGATTTCGACAACTGGCCTAGCACGGGAAGTT
TAGAACCTTTAGAGTGA
AA sequence
>Lus10018751 pacid=23176218 polypeptide=Lus10018751 locus=Lus10018751.g ID=Lus10018751.BGIv1.0 annot-version=v1.0
MVEINAALFLPESESSFDWHYDRTTFRSGCIATNFCLLHSDCELQWRQLIESKSEFGRSVDIPVLLPRSLAAFNRILSDNFAEEKELRLVRMNNNENVRI
YYLRSSVFLTSSLKEEDCVFHSNDFDNWPSTGSLEPLE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10018751 0 1
AT3G19184 B3 AP2/B3-like transcriptional fa... Lus10014044 4.1 0.7942
AT1G71750 HGPT Hypoxanthine-guanine phosphori... Lus10024262 6.0 0.7516
AT3G59330 Eukaryotic protein of unknown ... Lus10002279 9.7 0.7744
Lus10037800 11.7 0.7026
AT3G05950 RmlC-like cupins superfamily p... Lus10035278 12.8 0.7291
AT5G57880 MPS1, ATPRD2 ARABIDOPSIS THALIANA PUTATIVE ... Lus10010784 14.7 0.7779
AT1G03220 Eukaryotic aspartyl protease f... Lus10041224 17.5 0.7769
AT5G52860 ABCG8 ATP-binding cassette G8, ABC-2... Lus10039305 18.4 0.7798
Lus10019746 21.5 0.7005
AT5G02070 Protein kinase family protein ... Lus10020667 25.0 0.7176

Lus10018751 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.