Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G43700 193 / 1e-62 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) AT1G04240 185 / 3e-59 AUX_IAA IAA3, SHY2 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) AT4G14560 164 / 3e-51 AUX_IAA AXR5, IAA1 AUXIN RESISTANT 5, indole-3-acetic acid inducible (.1) AT3G23030 162 / 2e-50 AUX_IAA IAA2 indole-3-acetic acid inducible 2 (.1) AT3G04730 152 / 5e-46 AUX_IAA IAA16 indoleacetic acid-induced protein 16 (.1) AT3G23050 151 / 2e-45 AUX_IAA AXR2, IAA7 AUXIN RESISTANT 2, indole-3-acetic acid 7 (.1.2) AT1G04250 145 / 2e-43 AUX_IAA IAA17, AXR3 indole-3-acetic acid inducible 17, AUXIN RESISTANT 3, AUX/IAA transcriptional regulator family protein (.1) AT4G14550 145 / 3e-43 AUX_IAA SLR, IAA14 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) AT4G29080 142 / 5e-41 AUX_IAA IAA27, PAP2 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) AT3G15540 129 / 3e-37 AUX_IAA MSG2, IAA19 MASSUGU 2, indole-3-acetic acid inducible 19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024853 [exp] 328 / 3e-115 AT1G04240 216 / 1e-71 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10014729 [exp] 256 / 4e-87 AT1G04240 230 / 2e-77 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10002723 [exp] 256 / 6e-87 AT5G43700 221 / 4e-74 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10039413 [exp] 200 / 4e-65 AT1G04240 250 / 2e-85 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10039488 [exp] 198 / 3e-64 AT5G43700 247 / 3e-84 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10039414 [exp] 158 / 1e-47 AT4G14550 305 / 1e-105 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Lus10028222 [exp] 150 / 2e-44 AT5G65670 322 / 3e-110 indole-3-acetic acid inducible 9 (.1.2) Lus10042929 [exp] 143 / 1e-40 AT5G65670 356 / 3e-122 indole-3-acetic acid inducible 9 (.1.2) Lus10015907 [exp] 135 / 5e-39 AT3G04730 309 / 5e-107 indoleacetic acid-induced protein 16 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G218200 [exp] 228 / 3e-76 AT5G43700 243 / 2e-82 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.002G045000 [exp] 221 / 2e-73 AT5G43700 236 / 5e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.005G053800 [exp] 207 / 7e-68 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.013G041300 [exp] 204 / 7e-67 AT5G43700 239 / 5e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.008G161100 [exp] 185 / 8e-59 AT5G43700 238 / 3e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.010G078400 [exp] 183 / 2e-58 AT5G43700 248 / 9e-85 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.008G161200 [exp] 157 / 2e-47 AT4G14550 343 / 1e-120 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.013G041400 [exp] 153 / 5e-46 AT3G04730 306 / 6e-106 indoleacetic acid-induced protein 16 (.1) Potri.002G044900 [exp] 150 / 5e-45 AT4G14550 286 / 1e-98 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.005G218300 [exp] 148 / 3e-44 AT4G14550 292 / 7e-101 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02309 [flax] [poplar] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Lus10018764 pacid=23176212 polypeptide=Lus10018764 locus=Lus10018764.g ID=Lus10018764.BGIv1.0 annot-version=v1.0 ATGGAAAGATCATCATCCATGGAATATATGGCTTCCGATCTCAACCTCAAGGCCACAGAGCTCCGATTAGGCTTACCAGGAAGCGACCGCCGAGACGAGC CTGAGAAGTCACAGGCCAGCAGCACTTCTCCTACGACAACGCCCATTCTACTTAGAACTGGAATCATCATCAACAACAACTACAACAACAACAACAACAA CAAGAGATCCTCTCCGGAAGCGCCGTCGTCCGTCGACGAGTGCAAGTCGCAGAGCAATTCCAGTGCCTCCGATATCGAAGACGGTGACGGAGATTGCGCT CCTCCTCCCGCTAAAGCACAAGCGGTGGGATGGCCTCCGATCCGTTCGTACAGGAAGAGCTGCCTCGAGCAGAAGAAGAAGAGCGAGTATGTGAAAGTGA GCATGGACGGAGCTCCGTACCTCCGCAAGATCGACGTGAAGATGTACAAGAGCTATTACGAGCTGCTGAGTGGTTTGGAGAGCTTGTTCAAGCTCAAGTT CGGGGAGTACTCGGAGAGGGAAGGATACAACGGATCCGACTTCGCTCCGACTTACGAGGACAAGGACGGCGATTGGATGCTGGTGGGAGATGTGCCGTGG GAGATGTTCATCGGATCCTGCAAGAGGTTGAGGATAATGAGGGGATCCGAAGCTAGAGGGCTCGGTTGCATATAA
AA sequence Show only first row Show all	>Lus10018764 pacid=23176212 polypeptide=Lus10018764 locus=Lus10018764.g ID=Lus10018764.BGIv1.0 annot-version=v1.0 MERSSSMEYMASDLNLKATELRLGLPGSDRRDEPEKSQASSTSPTTTPILLRTGIIINNNYNNNNNNKRSSPEAPSSVDECKSQSNSSASDIEDGDGDCA PPPAKAQAVGWPPIRSYRKSCLEQKKKSEYVKVSMDGAPYLRKIDVKMYKSYYELLSGLESLFKLKFGEYSEREGYNGSDFAPTYEDKDGDWMLVGDVPW EMFIGSCKRLRIMRGSEARGLGCI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G43700	AUX_IAA	IAA4, ATAUX2-11	indole-3-acetic acid inducible...		Lus10018764 [exp]	0	1
AT2G45560		CYP76C1	"cytochrome P450, family 76, s...		Lus10027428 [exp]	2.4	0.9460
AT4G01950		ATGPAT3, GPAT3	glycerol-3-phosphate acyltrans...		Lus10002421 [exp]	2.6	0.9551
AT1G04240	AUX_IAA	IAA3, SHY2	SHORT HYPOCOTYL 2, indole-3-ac...		Lus10024853 [exp]	3.5	0.9330
AT5G23160			unknown protein		Lus10013437 [exp]	4.9	0.9400
AT2G44450		BGLU15	beta glucosidase 15 (.1)		Lus10030515 [exp]	6.0	0.9399
AT5G18030			SAUR-like auxin-responsive pro...		Lus10027317 [exp]	6.7	0.9363
AT5G24550		BGLU32	beta glucosidase 32 (.1)		Lus10030518 [exp]	7.0	0.9270
AT4G14550	AUX_IAA	SLR, IAA14	SOLITARY ROOT, indole-3-acetic...		Lus10039487 [exp]	7.3	0.9124
AT4G01950		ATGPAT3, GPAT3	glycerol-3-phosphate acyltrans...		Lus10001449 [exp]	7.4	0.9055
AT3G47640	bHLH	PYE, bHLH047, P...	POPEYE, basic helix-loop-helix...		Lus10008622 [exp]	8.2	0.8367

Compare expression of checked genes

Lus10018764 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.