Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04730 51 / 4e-08 AUX_IAA IAA16 indoleacetic acid-induced protein 16 (.1) AT3G23050 49 / 3e-07 AUX_IAA AXR2, IAA7 AUXIN RESISTANT 2, indole-3-acetic acid 7 (.1.2) AT1G04240 48 / 4e-07 AUX_IAA IAA3, SHY2 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) AT1G04250 48 / 5e-07 AUX_IAA IAA17, AXR3 indole-3-acetic acid inducible 17, AUXIN RESISTANT 3, AUX/IAA transcriptional regulator family protein (.1) AT4G29080 48 / 8e-07 AUX_IAA IAA27, PAP2 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) AT2G22670 47 / 2e-06 AUX_IAA IAA8 indoleacetic acid-induced protein 8 (.1.2.3.4) AT4G14550 46 / 3e-06 AUX_IAA SLR, IAA14 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) AT5G43700 43 / 3e-05 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) AT5G65670 42 / 0.0001 AUX_IAA IAA9 indole-3-acetic acid inducible 9 (.1.2) AT3G23030 41 / 0.0001 AUX_IAA IAA2 indole-3-acetic acid inducible 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024854 [exp] 162 / 5e-50 AT3G04730 221 / 3e-72 indoleacetic acid-induced protein 16 (.1) Lus10015907 [exp] 53 / 1e-08 AT3G04730 309 / 5e-107 indoleacetic acid-induced protein 16 (.1) Lus10039414 [exp] 51 / 7e-08 AT4G14550 305 / 1e-105 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Lus10014729 [exp] 50 / 9e-08 AT1G04240 230 / 2e-77 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10014731 [exp] 50 / 2e-07 AT3G04730 241 / 4e-80 indoleacetic acid-induced protein 16 (.1) Lus10039487 [exp] 49 / 4e-07 AT4G14550 232 / 5e-77 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Lus10002723 [exp] 47 / 1e-06 AT5G43700 221 / 4e-74 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10018764 [exp] 47 / 2e-06 AT5G43700 210 / 4e-69 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10034962 [exp] 46 / 3e-06 AT4G29080 289 / 4e-97 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G044900 [exp] 60 / 3e-11 AT4G14550 286 / 1e-98 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.005G218300 [exp] 60 / 4e-11 AT4G14550 292 / 7e-101 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.013G041400 [exp] 54 / 6e-09 AT3G04730 306 / 6e-106 indoleacetic acid-induced protein 16 (.1) Potri.003G051300 [exp] 52 / 3e-08 AT4G29080 298 / 3e-100 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) Potri.005G053900 [exp] 52 / 3e-08 AT3G04730 317 / 3e-110 indoleacetic acid-induced protein 16 (.1) Potri.001G177400 [exp] 50 / 1e-07 AT3G04730 211 / 8e-69 indoleacetic acid-induced protein 16 (.1) Potri.001G186100 [exp] 49 / 3e-07 AT4G29080 286 / 1e-95 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) Potri.010G078300 [exp] 48 / 9e-07 AT4G14550 319 / 1e-110 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.008G161200 [exp] 47 / 1e-06 AT4G14550 343 / 1e-120 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.005G218200 [exp] 46 / 3e-06 AT5G43700 243 / 2e-82 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02309 [flax] [poplar] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Lus10018765 pacid=23176285 polypeptide=Lus10018765 locus=Lus10018765.g ID=Lus10018765.BGIv1.0 annot-version=v1.0 ATGGAAGTGGAGATCATGAGGTTCGACGAGACGGAGCTCCGACTCGGCCTTCCCGGCGGTGGAGGAGGAGGAGAATTATTAGCTGCTCATGAGGTCGTGG GAAGCACTCCTACTACTCCTACTACAGCTCATCTCATGATCAGGAAGAGAGGCTTCTCCGAGACTGTTGATTTGCAGCTCAACCTCTCTTCTTCTCCTCC CTCCGCCGCCGCTAACAACAAAGATGCCGCTCCCGCGGGGGGCGAGGCGGCGGCGGCGAAGCTGATGGAGGATTGTACTAGTACTGGTACTACTCCTTCT GCTGCTGACAAGATGGAAGCTGCTGATCTGGCCACCTCCAAGCCTCCTCCTGCTAAGGCACAAGTGGTGGGATGGCCACCGGTGCGGTCGTTCAGGAAGA ACATGGTGTCGTCGGCGGCGGTCCAGAAGAGCACCAACGTTAACAACAAAAGTAACAAAGATGGTGTAGTGTCGGCGGCGGAGAGCGAGCATAAGGCGGC GGCTCCGGCTCCGTCAGCTGCTGTGGCGGGCTAG
AA sequence Show only first row Show all	>Lus10018765 pacid=23176285 polypeptide=Lus10018765 locus=Lus10018765.g ID=Lus10018765.BGIv1.0 annot-version=v1.0 MEVEIMRFDETELRLGLPGGGGGGELLAAHEVVGSTPTTPTTAHLMIRKRGFSETVDLQLNLSSSPPSAAANNKDAAPAGGEAAAAKLMEDCTSTGTTPS AADKMEAADLATSKPPPAKAQVVGWPPVRSFRKNMVSSAAVQKSTNVNNKSNKDGVVSAAESEHKAAAPAPSAAVAG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G04730	AUX_IAA	IAA16	indoleacetic acid-induced prot...		Lus10018765 [exp]	0	1
AT4G14550	AUX_IAA	SLR, IAA14	SOLITARY ROOT, indole-3-acetic...		Lus10018766 [exp]	1.0	0.9954
AT3G07010			Pectin lyase-like superfamily ...		Lus10011885 [exp]	1.4	0.9759
AT3G61640		AGP20, ATAGP20	arabinogalactan protein 20 (.1...		Lus10033939 [exp]	3.9	0.9743
AT3G04730	AUX_IAA	IAA16	indoleacetic acid-induced prot...		Lus10024854 [exp]	5.0	0.9698
AT1G64640		AtENODL8	early nodulin-like protein 8 (...		Lus10033227 [exp]	5.7	0.9717
AT5G03960		IQD12	IQ-domain 12 (.1)		Lus10018031 [exp]	5.7	0.9641
AT3G16850			Pectin lyase-like superfamily ...		Lus10016837 [exp]	5.9	0.9642
AT3G24450			Heavy metal transport/detoxifi...		Lus10017730 [exp]	6.0	0.9644
AT5G15140			Galactose mutarotase-like supe...		Lus10005251 [exp]	7.9	0.9634
AT3G24670			Pectin lyase-like superfamily ...		Lus10022817 [exp]	8.3	0.9472

Compare expression of checked genes

Lus10018765 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.