Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14550 145 / 2e-45 AUX_IAA SLR, IAA14 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) AT3G23050 141 / 1e-43 AUX_IAA AXR2, IAA7 AUXIN RESISTANT 2, indole-3-acetic acid 7 (.1.2) AT3G04730 139 / 6e-43 AUX_IAA IAA16 indoleacetic acid-induced protein 16 (.1) AT1G04250 131 / 9e-40 AUX_IAA IAA17, AXR3 indole-3-acetic acid inducible 17, AUXIN RESISTANT 3, AUX/IAA transcriptional regulator family protein (.1) AT5G65670 121 / 6e-35 AUX_IAA IAA9 indole-3-acetic acid inducible 9 (.1.2) AT4G29080 118 / 6e-34 AUX_IAA IAA27, PAP2 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) AT2G22670 117 / 1e-33 AUX_IAA IAA8 indoleacetic acid-induced protein 8 (.1.2.3.4) AT5G43700 112 / 9e-33 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) AT1G04240 108 / 2e-31 AUX_IAA IAA3, SHY2 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) AT4G14560 106 / 1e-30 AUX_IAA AXR5, IAA1 AUXIN RESISTANT 5, indole-3-acetic acid inducible (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024854 [exp] 191 / 8e-63 AT3G04730 221 / 3e-72 indoleacetic acid-induced protein 16 (.1) Lus10014731 [exp] 149 / 4e-46 AT3G04730 241 / 4e-80 indoleacetic acid-induced protein 16 (.1) Lus10006585 [exp] 140 / 9e-43 AT3G04730 254 / 3e-85 indoleacetic acid-induced protein 16 (.1) Lus10015907 [exp] 137 / 1e-41 AT3G04730 309 / 5e-107 indoleacetic acid-induced protein 16 (.1) Lus10039414 [exp] 133 / 4e-40 AT4G14550 305 / 1e-105 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Lus10002724 [exp] 131 / 5e-39 AT3G23050 212 / 5e-68 AUXIN RESISTANT 2, indole-3-acetic acid 7 (.1.2) Lus10011583 [exp] 125 / 2e-36 AT5G65670 333 / 2e-114 indole-3-acetic acid inducible 9 (.1.2) Lus10019241 [exp] 123 / 7e-36 AT5G65670 356 / 4e-123 indole-3-acetic acid inducible 9 (.1.2) Lus10012984 [exp] 120 / 9e-35 AT4G29080 280 / 8e-94 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G053900 [exp] 147 / 4e-46 AT3G04730 317 / 3e-110 indoleacetic acid-induced protein 16 (.1) Potri.002G044900 [exp] 145 / 4e-45 AT4G14550 286 / 1e-98 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.005G218300 [exp] 145 / 5e-45 AT4G14550 292 / 7e-101 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.013G041400 [exp] 142 / 6e-44 AT3G04730 306 / 6e-106 indoleacetic acid-induced protein 16 (.1) Potri.008G161200 [exp] 141 / 1e-43 AT4G14550 343 / 1e-120 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.010G078300 [exp] 137 / 1e-41 AT4G14550 319 / 1e-110 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.001G186100 [exp] 132 / 5e-39 AT4G29080 286 / 1e-95 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) Potri.003G051300 [exp] 128 / 1e-37 AT4G29080 298 / 3e-100 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) Potri.002G108000 [exp] 128 / 2e-37 AT5G65670 355 / 4e-122 indole-3-acetic acid inducible 9 (.1.2) Potri.001G177400 [exp] 118 / 6e-35 AT3G04730 211 / 8e-69 indoleacetic acid-induced protein 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02309 [flax] [poplar] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Lus10018766 pacid=23176181 polypeptide=Lus10018766 locus=Lus10018766.g ID=Lus10018766.BGIv1.0 annot-version=v1.0 ATGGACGGAGCTCCGTACCTGAGGAAGGTTGACCTGAAGATGTACGGAAGCTACAGAGAGCTGTCGGATGCGTTGACCAAGATGTTCGGTTCCGTAAAGG AGAGCAATGACTATGTCCCTACCTATGAGGACAAGGACGGCGACTGGATGCTCGTCGGCGATGTTCCTTGGGGGATGTTCGTGGAATCTTGCAAGCGGCT TCGCATCATGAAGGGCAACGAAGCAATTGGACTTGCACCAAGAGCCATGGAGAAACGCAAGAACATGAGCTAG
AA sequence Show only first row Show all	>Lus10018766 pacid=23176181 polypeptide=Lus10018766 locus=Lus10018766.g ID=Lus10018766.BGIv1.0 annot-version=v1.0 MDGAPYLRKVDLKMYGSYRELSDALTKMFGSVKESNDYVPTYEDKDGDWMLVGDVPWGMFVESCKRLRIMKGNEAIGLAPRAMEKRKNMS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G14550	AUX_IAA	SLR, IAA14	SOLITARY ROOT, indole-3-acetic...		Lus10018766 [exp]	0	1
AT3G04730	AUX_IAA	IAA16	indoleacetic acid-induced prot...		Lus10018765 [exp]	1.0	0.9954
AT5G03960		IQD12	IQ-domain 12 (.1)		Lus10018031 [exp]	1.7	0.9737
AT3G61640		AGP20, ATAGP20	arabinogalactan protein 20 (.1...		Lus10033939 [exp]	2.0	0.9787
AT3G07010			Pectin lyase-like superfamily ...		Lus10011885 [exp]	2.8	0.9730
AT4G14090			UDP-Glycosyltransferase superf...		Lus10040591 [exp]	3.3	0.9612
AT3G24450			Heavy metal transport/detoxifi...		Lus10017730 [exp]	3.7	0.9703
AT3G04730	AUX_IAA	IAA16	indoleacetic acid-induced prot...		Lus10024854 [exp]	4.2	0.9708
AT1G64640		AtENODL8	early nodulin-like protein 8 (...		Lus10033227 [exp]	5.9	0.9724
AT2G37640		ATHEXPALPHA1.9,...	ARABIDOPSIS THALIANA EXPANSIN ...		Lus10024388 [exp]	6.0	0.9333
AT5G15140			Galactose mutarotase-like supe...		Lus10005251 [exp]	6.3	0.9660

Compare expression of checked genes

Lus10018766 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.