Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30570 78 / 1e-20 PSBW photosystem II reaction center W (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033862 [exp] 86 / 3e-23 AT2G30570 137 / 2e-42 photosystem II reaction center W (.1) Lus10014751 [exp] 85 / 3e-23 AT2G30570 134 / 3e-41 photosystem II reaction center W (.1) Lus10024858 [exp] 84 / 6e-23 AT2G30570 132 / 1e-40 photosystem II reaction center W (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G044300 [exp] 77 / 4e-20 AT2G30570 120 / 8e-36 photosystem II reaction center W (.1) Potri.005G218800 [exp] 75 / 2e-19 AT2G30570 113 / 3e-33 photosystem II reaction center W (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07123 [flax] [poplar] PsbW Photosystem II reaction centre W protein (PsbW)
Representative CDS sequence Show only first row Show all	>Lus10018771 pacid=23176259 polypeptide=Lus10018771 locus=Lus10018771.g ID=Lus10018771.BGIv1.0 annot-version=v1.0 ATGGCGCTTGTGGACGTTAGGATGAGCACGGAAGGAACCGGGTTGCCGTTCGGGTTGAGCAACAACCTACTCGGGTGGATTCTATTGGGTGTGTTCGGAC TCATCTGGTCTCTCTACACCGTGTACACCTCGGATCTTGAGGAGGACGAGGAGTCCGGATTGTCTCTTTGA
AA sequence Show only first row Show all	>Lus10018771 pacid=23176259 polypeptide=Lus10018771 locus=Lus10018771.g ID=Lus10018771.BGIv1.0 annot-version=v1.0 MALVDVRMSTEGTGLPFGLSNNLLGWILLGVFGLIWSLYTVYTSDLEEDEESGLSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G30570		PSBW	photosystem II reaction center...		Lus10018771 [exp]	0	1
					Lus10018772 [exp]	2.2	0.9577
AT2G30570		PSBW	photosystem II reaction center...		Lus10024858 [exp]	4.5	0.9431
AT2G26500			cytochrome b6f complex subunit...		Lus10011665 [exp]	6.0	0.9385
AT4G22950	MADS	AGL19	AGAMOUS-like 19 (.1)		Lus10006715 [exp]	8.2	0.8919
AT3G08940		LHCB4.2	light harvesting complex photo...		Lus10027786 [exp]	8.4	0.9143
AT3G04790		EMB3119	EMBRYO DEFECTIVE 3119, Ribose ...		Lus10009181 [exp]	9.5	0.8942
AT1G09900			Pentatricopeptide repeat (PPR-...		Lus10037013 [exp]	10.2	0.8855
AT1G08380		PSAO	photosystem I subunit O (.1)		Lus10005199 [exp]	10.6	0.9241
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Lus10015831 [exp]	10.7	0.9149
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Lus10020418 [exp]	11.3	0.9138

Compare expression of checked genes

Lus10018771 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.