Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024858 [exp] 64 / 8e-15 AT2G30570 132 / 1e-40 photosystem II reaction center W (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G218800 [exp] 40 / 2e-05 AT2G30570 113 / 3e-33 photosystem II reaction center W (.1) Potri.002G044300 [exp] 38 / 9e-05 AT2G30570 120 / 8e-36 photosystem II reaction center W (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07123 [flax] [poplar] PsbW Photosystem II reaction centre W protein (PsbW)
Representative CDS sequence Show only first row Show all	>Lus10018772 pacid=23176276 polypeptide=Lus10018772 locus=Lus10018772.g ID=Lus10018772.BGIv1.0 annot-version=v1.0 ATGGCGTCAATCTCCGCAGCAACCTCCGCCACATCCTTCGTCAACGCCCCACTCCGTCACAAGCCTTCCCTATCCATCTCATCCTCCTCAGTCCTCGGGC TTCCGGCGATGGAGAAGAAAGGGAGACTGGTGGTGAAGTGCTCTGCGGAAGGAAAAGGTAGCAGCAACGGTAAGGCGATGGGCGCTTCCATGATGGCGGC TGCCACAGCTGCGGCGGTTTCTANNNGCTTCGGCGGTTTCTAG
AA sequence Show only first row Show all	>Lus10018772 pacid=23176276 polypeptide=Lus10018772 locus=Lus10018772.g ID=Lus10018772.BGIv1.0 annot-version=v1.0 MASISAATSATSFVNAPLRHKPSLSISSSSVLGLPAMEKKGRLVVKCSAEGKGSSNGKAMGASMMAAATAAAVSXXFGGF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018772 [exp]	0	1
AT2G26500			cytochrome b6f complex subunit...		Lus10011665 [exp]	1.0	0.9750
AT1G07700			Thioredoxin superfamily protei...		Lus10024726 [exp]	2.0	0.9608
AT2G30570		PSBW	photosystem II reaction center...		Lus10018771 [exp]	2.2	0.9577
AT1G76100		PETE1	plastocyanin 1 (.1)		Lus10005628 [exp]	3.0	0.9603
AT2G30570		PSBW	photosystem II reaction center...		Lus10024858 [exp]	4.9	0.9507
AT1G76080		ATCDSP32, CDSP3...	ARABIDOPSIS THALIANA CHLOROPLA...		Lus10017245 [exp]	4.9	0.9442
AT3G50820		OEC33, PSBO2, P...	OXYGEN EVOLVING COMPLEX SUBUNI...		Lus10016783 [exp]	5.3	0.9580
AT3G50820		OEC33, PSBO2, P...	OXYGEN EVOLVING COMPLEX SUBUNI...		Lus10022479 [exp]	6.5	0.9505
AT1G06680		PSII-P, OEE2, P...	OXYGEN-EVOLVING ENHANCER PROTE...		Lus10020717 [exp]	11.4	0.9400
AT5G58560		FOLK	farnesol kinase, Phosphatidate...		Lus10031858 [exp]	11.9	0.8537

Compare expression of checked genes

Lus10018772 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.