Lus10018777 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G09510 267 / 2e-93 Ribosomal protein S19 family protein (.1.2)
AT5G09500 266 / 3e-93 Ribosomal protein S19 family protein (.1)
AT1G04270 265 / 1e-92 RPS15 cytosolic ribosomal protein S15 (.1.2)
AT5G09490 261 / 4e-91 Ribosomal protein S19 family protein (.1)
AT5G43640 242 / 1e-83 Ribosomal protein S19 family protein (.1)
AT5G63070 192 / 1e-63 Ribosomal protein S19 family protein (.1)
AT1G33850 77 / 2e-19 Ribosomal protein S19 family protein (.1)
ATCG00820 45 / 1e-06 ATCG00820.1, RPS19 ribosomal protein S19 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033856 307 / 4e-109 AT5G09510 265 / 9e-93 Ribosomal protein S19 family protein (.1.2)
Lus10041168 298 / 3e-104 AT5G09510 260 / 6e-89 Ribosomal protein S19 family protein (.1.2)
Lus10021886 281 / 5e-96 AT5G09500 244 / 1e-81 Ribosomal protein S19 family protein (.1)
Lus10007469 267 / 2e-93 AT5G09500 250 / 6e-87 Ribosomal protein S19 family protein (.1)
Lus10026127 243 / 6e-84 AT5G09500 244 / 4e-84 Ribosomal protein S19 family protein (.1)
Lus10024865 242 / 6e-84 AT5G09500 222 / 4e-76 Ribosomal protein S19 family protein (.1)
Lus10008692 163 / 1e-52 AT5G09490 162 / 2e-52 Ribosomal protein S19 family protein (.1)
Lus10027711 43 / 1e-05 AT5G47320 123 / 3e-36 ribosomal protein S19 (.1)
Lus10003009 42 / 9e-05 AT5G47040 1420 / 0.0 lon protease 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G076900 291 / 6e-103 AT5G09510 267 / 2e-93 Ribosomal protein S19 family protein (.1.2)
Potri.002G043200 291 / 8e-103 AT5G09500 266 / 5e-93 Ribosomal protein S19 family protein (.1)
Potri.005G219700 276 / 3e-97 AT5G09500 266 / 6e-93 Ribosomal protein S19 family protein (.1)
Potri.008G161901 132 / 5e-41 AT5G09510 130 / 4e-41 Ribosomal protein S19 family protein (.1.2)
Potri.005G055401 95 / 2e-26 AT1G04270 97 / 3e-27 cytosolic ribosomal protein S15 (.1.2)
Potri.005G055534 76 / 3e-18 AT1G04270 77 / 1e-18 cytosolic ribosomal protein S15 (.1.2)
Potri.003G123750 67 / 2e-15 AT1G04270 67 / 4e-16 cytosolic ribosomal protein S15 (.1.2)
Potri.004G074201 56 / 1e-10 AT5G09500 52 / 1e-09 Ribosomal protein S19 family protein (.1)
Potri.013G137688 44 / 2e-06 ATCG00820 169 / 1e-56 ribosomal protein S19 (.1)
Potri.011G074301 44 / 2e-06 ATCG00820 168 / 2e-56 ribosomal protein S19 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00203 Ribosomal_S19 Ribosomal protein S19
Representative CDS sequence
>Lus10018777 pacid=23176256 polypeptide=Lus10018777 locus=Lus10018777.g ID=Lus10018777.BGIv1.0 annot-version=v1.0
ATGGCGGAAATTGAAGCCGATGTCGCTGTTACCGGCCAGCCGAAGAAGAGGACGTTCAAGAAGTTCAGTTTCAGGGGAGTCGATCTGGATGCTCTCTTGG
ACATGTCCACTGATGACCTCGTCAAGCTCTTTACTGCTCGTGCTCGTAGAAGGTTCCAGCGTGGTTTGACTAGGAAGCCAATGGCTCTGGTTAAGAAGCT
CCGCAAGGCTAAAAGAGAGGCTCCAGCTGGTGAGAAACCCGAGCCAGTCCGAACCCACCTGAGAAACATGATCATAGTCCCCGAGATGATCGGCAGTGTC
ATTGGTGTTTACAACGGTAAGACATTCAACCAAGTCGAAATCAAGCCTGAGATGATTGGACATTACCTAGCTGAGTTCTCAATCAGCTACAAGCCAGTGA
AGCATGGAAGACCCGGTATCGGTGCTACTCACTCCTCAAGGTTCATCCCCCTGAAGTGA
AA sequence
>Lus10018777 pacid=23176256 polypeptide=Lus10018777 locus=Lus10018777.g ID=Lus10018777.BGIv1.0 annot-version=v1.0
MAEIEADVAVTGQPKKRTFKKFSFRGVDLDALLDMSTDDLVKLFTARARRRFQRGLTRKPMALVKKLRKAKREAPAGEKPEPVRTHLRNMIIVPEMIGSV
IGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G09510 Ribosomal protein S19 family p... Lus10018777 0 1
AT5G48760 Ribosomal protein L13 family p... Lus10043151 4.7 0.9032
AT5G09500 Ribosomal protein S19 family p... Lus10024865 7.5 0.8932
AT1G09690 Translation protein SH3-like f... Lus10030882 7.7 0.8754
AT3G18600 P-loop containing nucleoside t... Lus10038950 8.5 0.8733
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Lus10020794 8.7 0.8848
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Lus10032918 11.8 0.8777
AT3G49010 RSU2, ATBBC1 40S RIBOSOMAL PROTEIN, breast ... Lus10013719 14.7 0.8706
AT3G07050 NSN1 nucleostemin-like 1, GTP-bindi... Lus10018881 15.5 0.8475
AT3G56150 ATTIF3C1, ATEIF... eukaryotic translation initiat... Lus10039984 15.6 0.8506
AT3G18190 TCP-1/cpn60 chaperonin family ... Lus10008670 15.7 0.8464

Lus10018777 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.