Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38870 64 / 1e-15 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT2G38900 53 / 6e-11 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2) AT5G43580 46 / 4e-08 UPI UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT3G46860 40 / 1e-05 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT5G43570 39 / 3e-05 Serine protease inhibitor, potato inhibitor I-type family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018784 [exp] 80 / 1e-21 AT2G38870 89 / 1e-25 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10002732 [exp] 65 / 8e-16 AT2G38870 76 / 4e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10024870 [exp] 62 / 2e-14 AT2G38870 94 / 2e-27 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10018786 [exp] 62 / 2e-14 AT2G38870 93 / 6e-27 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10014740 [exp] 61 / 3e-14 AT2G38870 77 / 2e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10024370 [exp] 39 / 4e-05 AT2G38870 47 / 3e-08 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10035626 [exp] 38 / 6e-05 AT2G38900 43 / 8e-07 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2) Lus10003225 [exp] 38 / 9e-05 AT2G38900 42 / 1e-06 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2) Lus10032655 [exp] 38 / 0.0002 AT1G52870 499 / 3e-176 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G075600 [exp] 67 / 1e-16 AT5G43580 80 / 3e-21 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075200 [exp] 66 / 3e-16 AT2G38870 76 / 4e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.009G028300 [exp] 63 / 4e-15 AT5G43580 76 / 7e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075300 [exp] 63 / 5e-15 AT5G43580 77 / 2e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075501 [exp] 63 / 5e-15 AT5G43580 77 / 2e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.002G042300 [exp] 62 / 2e-14 AT2G38870 68 / 5e-17 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075800 [exp] 60 / 6e-14 AT2G38870 76 / 3e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.006G212000 [exp] 60 / 8e-14 AT2G38870 81 / 5e-22 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.016G078800 [exp] 59 / 1e-13 AT2G38870 79 / 3e-21 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075400 [exp] 59 / 2e-13 AT2G38870 84 / 3e-23 Serine protease inhibitor, potato inhibitor I-type family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0367 [flax] [poplar] CI-2 PF00280 [flax] [poplar] potato_inhibit Potato inhibitor I family
Representative CDS sequence Show only first row Show all	>Lus10018783 pacid=23176254 polypeptide=Lus10018783 locus=Lus10018783.g ID=Lus10018783.BGIv1.0 annot-version=v1.0 ATGTCGACCGACTGCAAAGGTAAGACCTCATGGCCGGAGCTGTTGGGGACCAACGGGGATGCGGCGGTGGCAGTGGTTGAGAGGGAGAACGACAACGTTG ATGCGGCTGTGGTGCCGGAAGGGTCTTTCGTTACCCTAGATTTCAGGTGTGACCGTGTTCGGGTTTGGGTTGACACGGACACCAATAGGGTTGTCACCCG TGTTCCTCGGGTTGGTTAA
AA sequence Show only first row Show all	>Lus10018783 pacid=23176254 polypeptide=Lus10018783 locus=Lus10018783.g ID=Lus10018783.BGIv1.0 annot-version=v1.0 MSTDCKGKTSWPELLGTNGDAAVAVVERENDNVDAAVVPEGSFVTLDFRCDRVRVWVDTDTNRVVTRVPRVG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38870			Serine protease inhibitor, pot...		Lus10018783 [exp]	0	1
AT2G42350			RING/U-box superfamily protein...		Lus10005104 [exp]	1.0	0.9877
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Lus10016178 [exp]	1.7	0.9857
AT2G38870			Serine protease inhibitor, pot...		Lus10018786 [exp]	5.5	0.9861
AT3G15980			Coatomer, beta' subunit (.1.2....		Lus10026094 [exp]	6.6	0.9640
AT5G17740			P-loop containing nucleoside t...		Lus10003213 [exp]	8.0	0.9724
AT1G08080		ATACA7, ACA7	A. THALIANA ALPHA CARBONIC ANH...		Lus10021455 [exp]	9.2	0.9809
AT3G11840		PUB24	plant U-box 24 (.1)		Lus10004191 [exp]	11.5	0.9754
AT1G79460		ATKS1, ATKS, GA...	GA REQUIRING 2, ARABIDOPSIS TH...		Lus10034229 [exp]	11.8	0.9740
AT2G42360			RING/U-box superfamily protein...		Lus10005105 [exp]	12.0	0.9762
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10006119 [exp]	12.3	0.9412

Compare expression of checked genes

Lus10018783 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.