Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04645 50 / 2e-08 Plant self-incompatibility protein S1 family (.1) AT5G04347 48 / 1e-07 Plant self-incompatibility protein S1 family (.1) AT4G29035 46 / 6e-07 Plant self-incompatibility protein S1 family (.1) AT4G16295 45 / 2e-06 SPH1 S-protein homologue 1 (.1) AT4G16195 44 / 3e-06 Plant self-incompatibility protein S1 family (.1) AT5G06020 43 / 7e-06 Plant self-incompatibility protein S1 family (.1) AT1G11765 41 / 3e-05 Plant self-incompatibility protein S1 family (.1) AT5G38435 40 / 9e-05 SPH8 S-protein homologue 8 (.1) AT3G17080 39 / 0.0001 Plant self-incompatibility protein S1 family (.1) AT3G16970 39 / 0.0001 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002747 [exp] 85 / 2e-22 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10023195 [exp] 78 / 2e-19 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1) Lus10016329 [exp] 77 / 7e-19 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10022835 [exp] 76 / 3e-18 AT3G26880 47 / 2e-07 Plant self-incompatibility protein S1 family (.1) Lus10023194 [exp] 75 / 5e-18 AT2G06090 49 / 3e-08 Plant self-incompatibility protein S1 family (.1) Lus10002219 [exp] 71 / 8e-17 AT1G04645 40 / 2e-05 Plant self-incompatibility protein S1 family (.1) Lus10032383 [exp] 69 / 8e-16 AT4G24975 40 / 5e-05 Plant self-incompatibility protein S1 family (.1) Lus10011895 [exp] 70 / 1e-15 AT4G29035 72 / 3e-16 Plant self-incompatibility protein S1 family (.1) Lus10023196 [exp] 68 / 2e-15 AT2G06090 54 / 4e-10 Plant self-incompatibility protein S1 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G252500 [exp] 61 / 1e-12 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.016G066900 [exp] 54 / 5e-10 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.010G008300 [exp] 52 / 4e-09 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.018G148630 [exp] 50 / 3e-08 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1) Potri.018G148366 [exp] 45 / 6e-07 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1) Potri.004G199700 [exp] 42 / 1e-05 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1) Potri.018G148700 [exp] 40 / 9e-05 AT1G04645 88 / 5e-23 Plant self-incompatibility protein S1 family (.1) Potri.001G053300 [exp] 40 / 0.0001 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1) Potri.003G201300 [exp] 39 / 0.0003 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1) Potri.003G175200 [exp] 38 / 0.0004 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10018785 pacid=23176255 polypeptide=Lus10018785 locus=Lus10018785.g ID=Lus10018785.BGIv1.0 annot-version=v1.0 ATGGTAACGCTGGTTTTCGGAGCAACGACGATACTAATCATCATCACGGCAGGCCCGTCGACGGGCATCGCGGCGGTGTACGTTAGAAACGACCTAAGCA GCAAGTCCGCGGTCATTGTGCATTGCCAGTCGAAAGACGACGACCTCGAGGCCAACGTGGTTCAATTTGGGTCGGTGGTCGACTGGAGTTTCGAGCCCGA TTTTTCTACGCTGTTTTGGTGCGACCTGGCCTTGCAAGATAAGCGTCTTCACTTCGACGCGTTTCAGGAGGAGACATTCGGGTCGTATTGCGCGCATACG AACTGGGAGGTTGTGGATGCGGGGGTTTATAGGCAGTCCACTGCTTGTCAAGGAAGTGTCCTTCATCCGTGGAAAGGATTGGACATTTGA
AA sequence Show only first row Show all	>Lus10018785 pacid=23176255 polypeptide=Lus10018785 locus=Lus10018785.g ID=Lus10018785.BGIv1.0 annot-version=v1.0 MVTLVFGATTILIIITAGPSTGIAAVYVRNDLSSKSAVIVHCQSKDDDLEANVVQFGSVVDWSFEPDFSTLFWCDLALQDKRLHFDAFQEETFGSYCAHT NWEVVDAGVYRQSTACQGSVLHPWKGLDI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10018785 [exp]	0	1
					Lus10028940 [exp]	1.0	0.9678
AT1G03890			RmlC-like cupins superfamily p...		Lus10033893 [exp]	1.4	0.9373
					Lus10033191 [exp]	2.4	0.9242
AT2G28630		KCS12	3-ketoacyl-CoA synthase 12 (.1...		Lus10021821 [exp]	4.4	0.7883
AT5G16990			Zinc-binding dehydrogenase fam...		Lus10007853 [exp]	4.6	0.8459
AT4G15480		UGT84A1	UDP-Glycosyltransferase superf...		Lus10002810 [exp]	5.3	0.8055
AT5G20690			Leucine-rich repeat protein ki...		Lus10005175 [exp]	6.9	0.7284
AT2G29940		ABCG31, PDR3, A...	ATP-binding cassette G31, plei...		Lus10020550 [exp]	7.7	0.8762
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10029385 [exp]	8.9	0.8564
AT1G53240		mMDH1	mitochondrial malate dehydroge...		Lus10036186 [exp]	11.6	0.7031

Compare expression of checked genes

Lus10018785 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.