Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G23810 117 / 2e-33 TET8 tetraspanin8 (.1) AT4G28050 109 / 2e-30 TET7 tetraspanin7 (.1) AT4G30430 105 / 2e-28 TET9 tetraspanin9 (.1) AT3G12090 77 / 9e-18 TET6 tetraspanin6 (.1) AT3G45600 71 / 1e-15 TET3 tetraspanin3 (.1) AT5G60220 68 / 2e-14 TET4 tetraspanin4 (.1) AT1G18520 67 / 3e-14 TET11 tetraspanin11 (.1) AT5G46700 64 / 6e-13 TRN2, TET1 TORNADO 2, TETRASPANIN 1, Tetraspanin family protein (.1) AT2G19580 63 / 1e-12 TET2 tetraspanin2 (.1) AT1G63260 58 / 7e-11 TET10 tetraspanin10 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019965 [exp] 160 / 8e-50 AT2G23810 376 / 1e-132 tetraspanin8 (.1) Lus10015494 [exp] 159 / 2e-49 AT2G23810 370 / 2e-130 tetraspanin8 (.1) Lus10023216 [exp] 138 / 2e-41 AT2G23810 376 / 1e-132 tetraspanin8 (.1) Lus10008891 [exp] 137 / 7e-41 AT2G23810 377 / 5e-133 tetraspanin8 (.1) Lus10008889 [exp] 73 / 2e-16 AT4G28050 134 / 3e-38 tetraspanin7 (.1) Lus10023338 [exp] 71 / 9e-16 AT3G45600 347 / 1e-121 tetraspanin3 (.1) Lus10008563 [exp] 70 / 4e-15 AT2G19580 411 / 1e-146 tetraspanin2 (.1) Lus10041411 [exp] 69 / 4e-15 AT4G23410 257 / 5e-87 tetraspanin5 (.1) Lus10038473 [exp] 69 / 7e-15 AT3G45600 446 / 9e-160 tetraspanin3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G099800 [exp] 128 / 2e-37 AT2G23810 322 / 3e-111 tetraspanin8 (.1) Potri.006G177900 [exp] 122 / 3e-35 AT2G23810 317 / 4e-109 tetraspanin8 (.1) Potri.015G055700 [exp] 94 / 2e-24 AT1G18520 196 / 6e-62 tetraspanin11 (.1) Potri.009G015100 [exp] 77 / 7e-18 AT3G45600 388 / 7e-137 tetraspanin3 (.1) Potri.010G220300 [exp] 74 / 1e-16 AT3G12090 399 / 2e-141 tetraspanin6 (.1) Potri.008G041600 [exp] 70 / 4e-15 AT3G12090 397 / 2e-140 tetraspanin6 (.1) Potri.006G150400 [exp] 66 / 6e-14 AT2G19580 367 / 5e-129 tetraspanin2 (.1) Potri.001G107200 [exp] 65 / 2e-13 AT1G63260 416 / 1e-148 tetraspanin10 (.1.2.3) Potri.003G093000 [exp] 60 / 1e-11 AT5G46700 369 / 4e-130 TORNADO 2, TETRASPANIN 1, Tetraspanin family protein (.1) Potri.001G129300 [exp] 58 / 7e-11 AT4G28050 162 / 1e-48 tetraspanin7 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018792 pacid=23178438 polypeptide=Lus10018792 locus=Lus10018792.g ID=Lus10018792.BGIv1.0 annot-version=v1.0 ATGTTTCTCCTCATCGTCCTCCTCTTCTGCTTGACCATCTTCGCCGTTGTTGTCACCAGCAAAGGAGCCGGTCAAGCGGTGTCCAACTGCGGCTATAAGG ACTATAGATTGGGAGGATACTCCGATTGGTTACAGAAGAGAGTGACTAACCCCAAGCACTGGAATAAGATCCGGAGTTGTTTGATTAACGCTAAAGTTTG CTCCATGTTCAACGAGACTTATCTCTCTGATTCCATCGAGGGGTTCTACACTGAAAGACTGTCTTCTCTTCAGGTAAAGATTGGGGAAAAAGGTAATCCC CTTTTTCCAGATTGCCTCTTTTCTCACTTTTCAATTCCTTATCTCAATTTTGTTGGTGGCTCTTTTGAGTTCATATTGTGGATTTAG
AA sequence Show only first row Show all	>Lus10018792 pacid=23178438 polypeptide=Lus10018792 locus=Lus10018792.g ID=Lus10018792.BGIv1.0 annot-version=v1.0 MFLLIVLLFCLTIFAVVVTSKGAGQAVSNCGYKDYRLGGYSDWLQKRVTNPKHWNKIRSCLINAKVCSMFNETYLSDSIEGFYTERLSSLQVKIGEKGNP LFPDCLFSHFSIPYLNFVGGSFEFILWI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G23810		TET8	tetraspanin8 (.1)		Lus10018792 [exp]	0	1
AT2G38010			Neutral/alkaline non-lysosomal...		Lus10021122 [exp]	3.5	0.9266
AT1G70500			Pectin lyase-like superfamily ...		Lus10030888 [exp]	7.6	0.9350
					Lus10018742 [exp]	8.9	0.9302
AT1G63120		ATRBL2	RHOMBOID-like 2 (.1)		Lus10017840 [exp]	13.4	0.9254
AT1G23460			Pectin lyase-like superfamily ...		Lus10030602 [exp]	13.9	0.9276
AT2G38010			Neutral/alkaline non-lysosomal...		Lus10017188 [exp]	17.5	0.8506
AT5G07830		ATGUS2	glucuronidase 2 (.1)		Lus10015737 [exp]	19.4	0.9201
AT4G34210		ASK11	SKP1-like 11 (.1)		Lus10041874 [exp]	22.0	0.8892
AT3G45010		SCPL48	serine carboxypeptidase-like 4...		Lus10041338 [exp]	22.6	0.9220
AT5G07830		ATGUS2	glucuronidase 2 (.1)		Lus10003468 [exp]	24.2	0.9068

Compare expression of checked genes

Lus10018792 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.