Lus10018808 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G18880 57 / 1e-10 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1)
AT3G24255 56 / 3e-10 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1), RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.2)
AT1G33710 51 / 2e-08 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1)
AT4G04650 50 / 4e-08 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1)
AT1G43730 49 / 8e-08 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1)
AT2G02520 47 / 6e-07 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1)
AT5G16486 45 / 2e-06 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1)
AT1G60720 44 / 6e-06 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040060 76 / 2e-18 AT5G18880 40 / 1e-04 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1)
Lus10008147 74 / 5e-18 AT4G04650 58 / 8e-11 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1)
Lus10026142 71 / 3e-15 AT3G11440 370 / 5e-115 myb domain protein 65 (.1)
Lus10008685 66 / 2e-13 AT3G11440 357 / 3e-115 myb domain protein 65 (.1)
Lus10001530 0 / 1 AT5G23110 5981 / 0.0 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G000101 38 / 0.0006 AT3G24255 193 / 1e-53 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1), RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.2)
PFAM info
Representative CDS sequence
>Lus10018808 pacid=23178443 polypeptide=Lus10018808 locus=Lus10018808.g ID=Lus10018808.BGIv1.0 annot-version=v1.0
ATGCCTCGTTTCTCTATCTCTCATGTTTGGAATGATACTCGAAATCACACTCCTATAGTTATGTGGTGTGACTTAATCTGGAAGGGACCTTCTATTCTGA
AGCATACCTTTATCAATTCGCTTGTAATTAGGGGGAGGCTGGTTACAAATGGCTCTATGGCTGCTTGGGGATTGCACTGGGATATCTCATGCCTCTTGTG
TGATAATGGCCTGGATGACATTGATAATTTATTCATGGGTTGTCCTTACATTGATGCTATCCTTACCTATTTTGATGTTCACCTCGTTACTAATGGAGAT
AGACAGAAGGAGGTGGAAATTGCTGGAAGTAGATTTGTAGGTGCCACTGGTGCTGCGCAGTGA
AA sequence
>Lus10018808 pacid=23178443 polypeptide=Lus10018808 locus=Lus10018808.g ID=Lus10018808.BGIv1.0 annot-version=v1.0
MPRFSISHVWNDTRNHTPIVMWCDLIWKGPSILKHTFINSLVIRGRLVTNGSMAAWGLHWDISCLLCDNGLDDIDNLFMGCPYIDAILTYFDVHLVTNGD
RQKEVEIAGSRFVGATGAAQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G18880 RNA-directed DNA polymerase (r... Lus10018808 0 1
Lus10000325 2.8 1.0000
AT2G46760 D-arabinono-1,4-lactone oxidas... Lus10004735 4.9 1.0000
Lus10002099 5.5 1.0000
AT1G17930 Aminotransferase-like, plant m... Lus10005495 7.7 1.0000
Lus10025316 8.1 1.0000
Lus10011594 8.7 1.0000
AT2G40780 Nucleic acid-binding, OB-fold-... Lus10030510 8.8 1.0000
Lus10032121 9.4 1.0000
AT5G39200 unknown protein Lus10030710 9.4 1.0000
AT4G20800 FAD-binding Berberine family p... Lus10006507 10.2 1.0000

Lus10018808 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.