Gene [FLAX] | FIBexDB

Lus10018809 [FLAX]

External link

JGI Phytozome v13

[genome browser]

Symbol

Arabidopsis homologues

Show only best Show top 10

No hit found

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10009741 [exp]	133 / 3e-39	ND	/
Lus10012401 [exp]	124 / 2e-37	ND	/
Lus10000886 [exp]	112 / 9e-32	ND	/
Lus10035382 [exp]	111 / 9e-30	AT4G15880	50 / 2e-06	EARLY IN SHORT DAYS 4, Cysteine proteinases superfamily protein (.1)
Lus10023136 [exp]	106 / 2e-29	ND	/
Lus10043174 [exp]	98 / 1e-25	ND	/
Lus10032843 [exp]	91 / 1e-24	ND	/
Lus10010773 [exp]	92 / 2e-24	ND	/
Lus10032677 [exp]	89 / 8e-23	ND	/

Poplar homologues

Show only best Show top 10

No hit found

PFAM info

Clan ID	Clan name	Pfam ID	Pfam name	Pfam description
CL0125 [flax] [poplar]	Peptidase_CA	PF02902 [flax] [poplar]	Peptidase_C48	Ulp1 protease family, C-terminal catalytic domain

Representative CDS sequence

Show only first row Show all

>Lus10018809 pacid=23178422 polypeptide=Lus10018809 locus=Lus10018809.g ID=Lus10018809.BGIv1.0 annot-version=v1.0

ATGCCGGGAGAAATGACAAGAAAAATGATGGTGTTCTTCCCAACCCATGCTGGGGACGCGTTAAAGCACTACTACGTGTTTGGGTTGGACATGGAGAGGA

AGGAGAAGTTTTTTCTTAACAACATGGTATGTCAGAAGGACTTTGAGACGGAACCGTATTACAAAGTGACAGGGGCAAGGATGATGGAATATGCGAGGTC

ATTCGTGCTTCTAAACAATGAAGTTGATATTAAAGAATTTTGGTGGAGGGTTGTGTATGCTCCACAACAGTCAAACTTACACAGCTGTGGATTATATGCA

CTTAATTTCATGGAGCATTACGTGGGTCGTTTCACCACGGACCAAACCAACCAGTGGCATGAGGAGGCTGTTATCACCAAAGATAGGTTGAAGTGCTTCA

TCCGGCCCATGTTATCGTAA

AA sequence

Show only first row Show all

>Lus10018809 pacid=23178422 polypeptide=Lus10018809 locus=Lus10018809.g ID=Lus10018809.BGIv1.0 annot-version=v1.0

MPGEMTRKMMVFFPTHAGDALKHYYVFGLDMERKEKFFLNNMVCQKDFETEPYYKVTGARMMEYARSFVLLNNEVDIKEFWWRVVYAPQQSNLHSCGLYA

LNFMEHYVGRFTTDQTNQWHEEAVITKDRLKCFIRPMLS

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018809 [exp]	0	1

Lus10018809 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.