Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038768 [exp] 49 / 2e-09 ND / Lus10039096 [exp] 45 / 3e-07 AT3G13290 131 / 2e-33 varicose-related (.1) Lus10038743 [exp] 38 / 3e-05 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G002900 [exp] 64 / 2e-15 ND / Potri.006G017750 [exp] 64 / 2e-15 ND / Potri.006G002301 [exp] 59 / 2e-13 ND / Potri.006G002401 [exp] 50 / 6e-10 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018816 pacid=23144690 polypeptide=Lus10018816 locus=Lus10018816.g ID=Lus10018816.BGIv1.0 annot-version=v1.0 ATGGTGAGGAAAGACAAGGTGTTGATAGCTCTGATATGGATGCTGGTGATGGTGTCCACAATTGCTATGTCTGCAGCAGCTACTGATCGCTCGCACAACT TCCACCATATGGTTCAACCACAAGCAGGTTGCCGGTGCTGCAATTTTGTTGGGAGGATCCCAAATATGAGATGTGGAAAAGTATGCTGCCAAGATGGCTG CTGCTTCAAAGCTTGA
AA sequence Show only first row Show all	>Lus10018816 pacid=23144690 polypeptide=Lus10018816 locus=Lus10018816.g ID=Lus10018816.BGIv1.0 annot-version=v1.0 MVRKDKVLIALIWMLVMVSTIAMSAAATDRSHNFHHMVQPQAGCRCCNFVGRIPNMRCGKVCCQDGCCFKA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018816 [exp]	0	1
AT5G65030			unknown protein		Lus10026048 [exp]	1.4	0.9670
AT1G08630		THA1	threonine aldolase 1 (.1.2.3.4...		Lus10014658 [exp]	3.2	0.9674
AT1G77210		AtSTP14	sugar transport protein 14, su...		Lus10022421 [exp]	5.7	0.9610
AT4G30420			nodulin MtN21 /EamA-like trans...		Lus10019970 [exp]	8.8	0.9544
AT1G12780		ATUGE1, UGE1	A. THALIANA UDP-GLC 4-EPIMERAS...		Lus10029572 [exp]	10.7	0.9636
					Lus10031312 [exp]	11.5	0.9283
AT2G45510		CYP704A2	"cytochrome P450, family 704, ...		Lus10038896 [exp]	14.8	0.9509
AT5G49360		ATBXL1, BXL1	beta-xylosidase 1 (.1)		Lus10016858 [exp]	15.2	0.9574
AT4G32480			Protein of unknown function (D...		Lus10033683 [exp]	15.3	0.9307
AT5G46050		ATPTR3, PTR3	ARABIDOPSIS THALIANA PEPTIDE T...		Lus10011786 [exp]	15.6	0.9051

Compare expression of checked genes

Lus10018816 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.