Lus10018872 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15352 91 / 4e-26 ATCOX17 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1)
AT1G53030 89 / 4e-25 Cytochrome C oxidase copper chaperone (COX17) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035780 96 / 6e-28 AT3G15352 103 / 5e-31 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1)
Lus10037356 94 / 5e-27 AT3G15352 101 / 3e-30 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G119000 89 / 2e-25 AT3G15352 97 / 2e-28 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1)
Potri.001G400000 89 / 7e-25 AT3G15352 102 / 6e-30 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0351 CHCH PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Representative CDS sequence
>Lus10018872 pacid=23144661 polypeptide=Lus10018872 locus=Lus10018872.g ID=Lus10018872.BGIv1.0 annot-version=v1.0
ATGGGCAGTTTGTCATCAAAGCAGGACACTTTATCTTCTTCTTCCCCTGCCATGGGGTCTCAACAGGAACCTGCAAAGCCGACGAAGAAGAAGATATGCT
GCGCCTGCCCAGACACCAAGAAGCTACGAGACGAATGCATCGTCGAACACGGTGAATCAGCTTGTTCGAAGTGGATCGATGCGCATCTTATGTGCCTTCG
TGCCGAAGGATTCAACGTTTGA
AA sequence
>Lus10018872 pacid=23144661 polypeptide=Lus10018872 locus=Lus10018872.g ID=Lus10018872.BGIv1.0 annot-version=v1.0
MGSLSSKQDTLSSSSPAMGSQQEPAKPTKKKICCACPDTKKLRDECIVEHGESACSKWIDAHLMCLRAEGFNV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G15352 ATCOX17 ARABIDOPSIS THALIANA CYTOCHROM... Lus10018872 0 1
AT1G65410 ABCI13, TGD3, A... TRIGALACTOSYLDIACYLGLYCEROL 3,... Lus10020188 3.5 0.7992
AT3G10920 MSD1, MEE33, AT... MATERNAL EFFECT EMBRYO ARREST ... Lus10034222 10.7 0.8162
AT5G44710 unknown protein Lus10038399 17.0 0.8016
AT1G20870 HSP20-like chaperones superfam... Lus10030721 25.1 0.7699
AT4G36910 CBSX1, CDCP2, L... LOSS OF THE TIMING OF ET AND J... Lus10041576 33.2 0.7737
AT3G21220 ATMAP2K_ALPHA, ... ARABIDOPSIS THALIANA MITOGEN-A... Lus10037340 39.8 0.7531
AT1G07130 STN1, ATSTN1 Nucleic acid-binding, OB-fold-... Lus10042621 41.6 0.7841
AT3G48030 hypoxia-responsive family prot... Lus10002358 41.9 0.7613
AT2G33040 ATP3 gamma subunit of Mt ATP syntha... Lus10007534 42.4 0.7848
AT4G26500 SUFE1, EMB1374,... SULFUR E 1, MBRYO DEFECTIVE 13... Lus10015605 48.4 0.7737

Lus10018872 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.