Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G49070 56 / 2e-10 Protein of unknown function (DUF677) (.1) AT3G19330 48 / 8e-08 Protein of unknown function (DUF677) (.1), Protein of unknown function (DUF677) (.2), Protein of unknown function (DUF677) (.3) AT1G20180 44 / 2e-06 Protein of unknown function (DUF677) (.1), Protein of unknown function (DUF677) (.2) AT3G19250 43 / 4e-06 Protein of unknown function (DUF677) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028573 [exp] 139 / 6e-43 AT3G49070 102 / 4e-25 Protein of unknown function (DUF677) (.1) Lus10039258 [exp] 47 / 9e-08 AT3G49070 168 / 1e-50 Protein of unknown function (DUF677) (.1) Lus10017286 [exp] 45 / 1e-06 AT1G20180 265 / 1e-85 Protein of unknown function (DUF677) (.1), Protein of unknown function (DUF677) (.2) Lus10010144 [exp] 45 / 2e-06 AT1G20180 260 / 4e-83 Protein of unknown function (DUF677) (.1), Protein of unknown function (DUF677) (.2) Lus10005612 [exp] 43 / 7e-06 AT1G20180 268 / 1e-86 Protein of unknown function (DUF677) (.1), Protein of unknown function (DUF677) (.2) Lus10017348 [exp] 38 / 0.0003 AT1G20180 255 / 4e-81 Protein of unknown function (DUF677) (.1), Protein of unknown function (DUF677) (.2) Lus10031977 [exp] 38 / 0.0004 AT3G19330 284 / 2e-93 Protein of unknown function (DUF677) (.1), Protein of unknown function (DUF677) (.2), Protein of unknown function (DUF677) (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G193000 [exp] 69 / 2e-15 AT1G20180 155 / 8e-44 Protein of unknown function (DUF677) (.1), Protein of unknown function (DUF677) (.2) Potri.002G067300 [exp] 65 / 9e-14 AT1G20180 130 / 2e-34 Protein of unknown function (DUF677) (.1), Protein of unknown function (DUF677) (.2) Potri.015G147400 [exp] 50 / 2e-08 AT3G49070 253 / 1e-80 Protein of unknown function (DUF677) (.1) Potri.005G243800 [exp] 44 / 3e-06 AT1G20180 252 / 2e-80 Protein of unknown function (DUF677) (.1), Protein of unknown function (DUF677) (.2) Potri.002G018200 [exp] 43 / 6e-06 AT1G20180 288 / 2e-94 Protein of unknown function (DUF677) (.1), Protein of unknown function (DUF677) (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018879 pacid=23144647 polypeptide=Lus10018879 locus=Lus10018879.g ID=Lus10018879.BGIv1.0 annot-version=v1.0 ATGGGTCCCATGGCTGTCGTCGGCGGCTGGTTTGGTCCGGTGAAGAAGCTCGTGAAGAAAGTTATTAGCTTTAATGTAAGTAAGGACGAGCATCGGACGC CTGAGAAGGTTCATTGCCAATTAGACATTGCAACGAAATGTGTGTACATGTTGAACAAAGACATGGACACAGTGAGCCGGCAAGTGACGAGGCTTCATGA TGAAGTGGAGCACGGGAAGGAGATGGTGAAGTTTTGGTCGGAGAAAATGTCGAAATTAGGAGACGATACATAA
AA sequence Show only first row Show all	>Lus10018879 pacid=23144647 polypeptide=Lus10018879 locus=Lus10018879.g ID=Lus10018879.BGIv1.0 annot-version=v1.0 MGPMAVVGGWFGPVKKLVKKVISFNVSKDEHRTPEKVHCQLDIATKCVYMLNKDMDTVSRQVTRLHDEVEHGKEMVKFWSEKMSKLGDDT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G49070			Protein of unknown function (D...		Lus10018879 [exp]	0	1
AT4G02250			Plant invertase/pectin methyle...		Lus10001464 [exp]	1.4	0.8358
					Lus10018846 [exp]	4.1	0.8581
AT1G62300	WRKY	ATWRKY6, WRKY6	WRKY family transcription fact...		Lus10021554 [exp]	4.6	0.8160
AT5G66660			Protein of unknown function (D...		Lus10018880 [exp]	4.9	0.8102
AT5G42020		BIP2, BIP	luminal binding protein, Heat ...		Lus10017022 [exp]	4.9	0.7582
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Lus10012001 [exp]	5.9	0.7694
AT1G23350			Plant invertase/pectin methyle...		Lus10013043 [exp]	8.7	0.7263
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10003264 [exp]	9.2	0.7386
					Lus10035026 [exp]	13.9	0.7435
					Lus10023352 [exp]	14.7	0.7435

Compare expression of checked genes

Lus10018879 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.