Plant FIBer expression Database

Lus10018880 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G067300
[exp]
66 / 1e-12 AT1G20180 130 / 2e-34 Protein of unknown function (DUF677) (.1), Protein of unknown function (DUF677) (.2)
Potri.005G193000
[exp]
57 / 9e-10 AT1G20180 155 / 8e-44 Protein of unknown function (DUF677) (.1), Protein of unknown function (DUF677) (.2)
PFAM info
Representative CDS sequence
>Lus10018880 pacid=23144671 polypeptide=Lus10018880 locus=Lus10018880.g ID=Lus10018880.BGIv1.0 annot-version=v1.0
ATGTGGCCAAAGTTCAAATCTTTCAAGAAAGATCAAAGATCAGCCGATCGCAATAAAGGGCTAAATCTCAATGACAAATACCATAGAATGTTAAGGAAGC
AATCATACGTGGAGTTCTCTACCAAAGCTCAAACCCTAGCCAATAACCACCACAGCTCACCATCACCGTCTTCATTAATTCAACATGAACCTCTACTTCT
CCTTCTCGAACCCGACCAAGCTTCGATCCGGTCAATTCTCGATTCAACCATCGTGCTCTTGAAATTCTCCGACCTTAAACCCCTATTCCTCAGCTACTTC
GACTCAACTGCTGATTCCTCGCGATTTTGCACCCACCTACTCACCCGTATAGCCCGAACCACCTACCCTGCACGCCAATTGTTCGACGAAATGCCAATAG
AGACATCATCCTTTGTCTCGGACCTCGTTAATAATTCGGTTGTATCCGAATCGAGCAATTATTCGTCCTCGTCCATGGAAGACTTCATCGAAAGCATTCG
AAATCGACACTCCTTGGTTTTGGAAGAGATGAAATCAAAGAGGAGAAAAGTGAAGAGGAAGATCAAGGTGATTGGTTAA
AA sequence
>Lus10018880 pacid=23144671 polypeptide=Lus10018880 locus=Lus10018880.g ID=Lus10018880.BGIv1.0 annot-version=v1.0
MWPKFKSFKKDQRSADRNKGLNLNDKYHRMLRKQSYVEFSTKAQTLANNHHSSPSPSSLIQHEPLLLLLEPDQASIRSILDSTIVLLKFSDLKPLFLSYF
DSTADSSRFCTHLLTRIARTTYPARQLFDEMPIETSSFVSDLVNNSVVSESSNYSSSSMEDFIESIRNRHSLVLEEMKSKRRKVKRKIKVIG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G66660 Protein of unknown function (D... Lus10018880
[exp]
0 1
AT1G62300 WRKY ATWRKY6, WRKY6 WRKY family transcription fact... Lus10021554
[exp]
1.0 0.9175
AT4G02250 Plant invertase/pectin methyle... Lus10001464
[exp]
2.4 0.8235
AT3G04070 NAC ANAC047 NAC domain containing protein ... Lus10021992
[exp]
3.2 0.8700
AT1G69490 NAC NAP, ANAC029, A... Arabidopsis NAC domain contain... Lus10026617
[exp]
4.5 0.8206
AT3G49070 Protein of unknown function (D... Lus10018879
[exp]
4.9 0.8102
AT1G23350 Plant invertase/pectin methyle... Lus10013043
[exp]
5.7 0.7618
Lus10018846
[exp]
9.5 0.8120
AT4G18050 ABCB9, PGP9 ATP-binding cassette B9, P-gly... Lus10004583
[exp]
12.0 0.7770
AT5G61990 Pentatricopeptide repeat (PPR)... Lus10016725
[exp]
12.1 0.7307
AT4G04750 Major facilitator superfamily ... Lus10018957
[exp]
13.7 0.7697

Lus10018880 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.