Lus10018893 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04554 Extensin_2 Extensin-like region
Representative CDS sequence
>Lus10018893 pacid=23144720 polypeptide=Lus10018893 locus=Lus10018893.g ID=Lus10018893.BGIv1.0 annot-version=v1.0
ATGGCTTCTATCAATATTGCCACTCTTTTAGTGGCGATATTTTTCCTACTTAGTCCAATGAAGCCATACAAGTACAAGTCACCACCACCGCCGCCAGTCT
ATAAGTCTCCTCCACCACCGGTGTACAAGTACAAATCTCCTCCCCCGCCGGTTTACAAGTACAAGTCACCACCACCGCCGCCAGTCTATAAGTCTCCTCC
ACCACCGGTGTACAAGTACAAATCTCCTCCCCCGCCGGTTTACAAGTACAAGTCACCACCGCCACCGGTGTACAAGTCGCCTCCTCCACCAACAAAGCCA
TACAAGTACAAGTCTCCACCACCACCAGTCTATAAGTCACCACCGCCACCGGTTTACAAGTAA
AA sequence
>Lus10018893 pacid=23144720 polypeptide=Lus10018893 locus=Lus10018893.g ID=Lus10018893.BGIv1.0 annot-version=v1.0
MASINIATLLVAIFFLLSPMKPYKYKSPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKSPPPPTKP
YKYKSPPPPVYKSPPPPVYK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10018893 0 1
Lus10018894 1.0 0.9957
Lus10028589 1.4 0.9729
AT1G76680 OPR1, ATOPR1 ARABIDOPSIS 12-OXOPHYTODIENOAT... Lus10001275 3.5 0.9631
AT1G49820 MTK1, ATMTK 5-methylthioribose kinase 1, S... Lus10027858 9.5 0.9478
AT5G24318 O-Glycosyl hydrolases family 1... Lus10021088 11.0 0.9617
Lus10002555 11.4 0.9637
AT1G71695 Peroxidase superfamily protein... Lus10028689 11.7 0.9686
AT3G23250 MYB ATMYB15, ATY19 myb domain protein 15 (.1.2) Lus10033889 12.6 0.9650
AT4G26270 PFK3 phosphofructokinase 3 (.1) Lus10043044 14.1 0.9626
AT5G40850 UPM1 urophorphyrin methylase 1 (.1.... Lus10037476 15.7 0.9626

Lus10018893 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.