Lus10018927 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G02680 159 / 2e-51 TAF13 TBP-associated factor 13 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028629 250 / 4e-87 AT1G02680 166 / 2e-54 TBP-associated factor 13 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G122500 180 / 2e-59 AT1G02680 169 / 2e-55 TBP-associated factor 13 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF02269 TFIID-18kDa Transcription initiation factor IID, 18kD subunit
Representative CDS sequence
>Lus10018927 pacid=23144740 polypeptide=Lus10018927 locus=Lus10018927.g ID=Lus10018927.BGIv1.0 annot-version=v1.0
ATGAGCACTTCCGGAACTCCTGGACAGGCAACCAAATCCGCAAAGGTTGCTGGCCCTTCGTCACACTCGTCGGAACCATCTACTAAGAGGAAACGAGGAG
TCTTCCAGAAAGATCTGCAGCACATGATGTATGGATTTGGAGACGATCCTAATCCGCTTCCGGAAAGTTTAGCACTTTTGGAGGACATTGTTGTAGAGTA
TGTCACTGATCTGATCATAATCAGTGTTACTTGCTCCATTGCTGTAAAGACACATAAAGCACTTGACGTAGGATCGAAAAGGGCGAGAATATCAGTCGAG
GATTTCCTGTACTTGATTCGCAAGGACCCACCGAAGCTCAACAGATGTACGGAACTGCTGTCAATGCAAGAGGAGCTGAAACAAGCAAGGAAAGCTTTTG
ATATGGACGACGAGAAACGGGTGCTTGAGTGA
AA sequence
>Lus10018927 pacid=23144740 polypeptide=Lus10018927 locus=Lus10018927.g ID=Lus10018927.BGIv1.0 annot-version=v1.0
MSTSGTPGQATKSAKVAGPSSHSSEPSTKRKRGVFQKDLQHMMYGFGDDPNPLPESLALLEDIVVEYVTDLIIISVTCSIAVKTHKALDVGSKRARISVE
DFLYLIRKDPPKLNRCTELLSMQEELKQARKAFDMDDEKRVLE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G02680 TAF13 TBP-associated factor 13 (.1) Lus10018927 0 1
AT5G58740 HSP20-like chaperones superfam... Lus10018234 3.2 0.9152
AT4G32960 unknown protein Lus10007456 7.5 0.8977
AT1G11400 PYM partner of Y14-MAGO (.1.2.3) Lus10002977 10.0 0.9011
AT1G28490 OSM1, ATSYP61, ... syntaxin of plants 61 (.1.2) Lus10017686 10.7 0.9037
AT2G26430 ATRCY1, RCY1 arginine-rich cyclin 1 (.1.2.3... Lus10041418 11.4 0.9064
AT5G22080 Chaperone DnaJ-domain superfam... Lus10013354 12.8 0.9005
AT5G05210 Surfeit locus protein 6 (.1.2) Lus10014455 14.7 0.8849
AT5G59140 BTB/POZ domain-containing prot... Lus10040746 15.5 0.8796
AT3G48140 B12D protein (.1) Lus10042151 17.2 0.8908
AT5G22080 Chaperone DnaJ-domain superfam... Lus10004099 17.7 0.8842

Lus10018927 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.