Lus10018950 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G60290 147 / 3e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G36690 145 / 2e-40 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G44800 143 / 9e-40 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G10490 140 / 6e-39 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G10500 137 / 8e-38 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G77330 125 / 2e-33 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G24530 124 / 9e-33 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G17020 124 / 1e-32 ATSRG1, SRG1 senescence-related gene 1 (.1)
AT2G30830 122 / 4e-32 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G05600 120 / 3e-31 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018949 537 / 0 AT2G44800 148 / 1e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10001460 448 / 2e-159 AT2G36690 149 / 7e-42 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10011263 266 / 9e-90 AT4G25420 50 / 2e-07 GA REQUIRING 5, ARABIDOPSIS THALIANA GIBBERELLIN 20-OXIDASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10001711 150 / 2e-43 AT2G36690 204 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10014398 152 / 6e-43 AT2G36690 482 / 4e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10023890 149 / 6e-42 AT2G36690 486 / 5e-173 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10030185 144 / 3e-40 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005037 141 / 8e-39 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10011979 134 / 3e-36 AT1G17020 374 / 4e-129 senescence-related gene 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G185000 410 / 2e-144 AT2G36690 147 / 5e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G048900 196 / 7e-60 AT2G36690 250 / 5e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G048700 189 / 2e-57 AT2G36690 255 / 3e-82 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G451700 161 / 7e-47 AT4G10500 451 / 6e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G150100 149 / 2e-42 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G451900 148 / 7e-42 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G451600 147 / 2e-41 AT4G10500 406 / 5e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G080600 144 / 2e-40 AT5G07480 453 / 9e-161 KAR-UP oxidoreductase 1 (.1)
Potri.008G029700 143 / 1e-39 AT2G36690 478 / 1e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G150200 142 / 1e-39 AT4G10500 323 / 1e-109 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10018950 pacid=23144754 polypeptide=Lus10018950 locus=Lus10018950.g ID=Lus10018950.BGIv1.0 annot-version=v1.0
ATGGTTCAAGTTCATTCAACACAAGTACTGGAAGTAGTGGTGGATGAAGAGATCCCAACCATAGATTACTTCTCCCTCTTCTCCTCCGACCCTATCAAGC
GGTTCGATGCACTCGCACGCCTCTCATCTGCCTGTGAAGACTACGGGTTTTTCAACTTGGTGAACCACGGGATACCGGATGAAGTGATGGAAGGTGCACT
AAGCGGGATTGGAGACTTCTTCGAGAAGAGTGGTGTGGAGGAGAAGAGAAAGTATAGGAAAAGAGATCCAAAGGCTAGGATTCTTTGGGATGCCAGGTGT
CATGCCGGCGAGAATAGGGAACATCTTAAACTACTCGCTCGTCCTAAGCTCCATTGCCCTCCTAATCCTCCGTCTTTTAGGAAGGCTTTGGGAGATTACG
TGACCAAGTTCCACCAAGTGAAGCTAGGGCTAGCAAGAGCAATGTCCACGATCTTGGGACAAGAGGAGTCCTACATCGAGACAGCTTTCGATCTTGAGTC
AGGCTTCGACGTGGCAGCAATGAATCGATACCCACCGAATTTCGAGTCGAATGGAACCATGGGTTTGGCCGAACACACCGATCCGGGATTCATCATCTCC
CTTATACAAGACATGGACGGCGGACTTCAAATCCTGACCCACCAAGGAAATTGGGTCAACGTCCATATCCCTTGTAATGCCATCTTAATTCAGCTTGGCG
ACCAACTTGAGGTTCTAACGAATGGCAAGTACAAAAGTCACATTCACCGTGTGTTGGTAGGTAGCTACAAGACTAAGAGGATTTCCTTAGGCACGCTTCA
TGGACCATCCATCGACAAATTCGTGGCTCCCGCTCTAGAGTTTGTTGACGAGACTCGTTGTTCGGGTTACCTTGGAATGACTTACTCTGGAGCTTTGGAA
GCTAATGATCGTTATGAGATTGAAGTCCAATCGTGCATCGAACAACTTAGAAAGATCATCTGA
AA sequence
>Lus10018950 pacid=23144754 polypeptide=Lus10018950 locus=Lus10018950.g ID=Lus10018950.BGIv1.0 annot-version=v1.0
MVQVHSTQVLEVVVDEEIPTIDYFSLFSSDPIKRFDALARLSSACEDYGFFNLVNHGIPDEVMEGALSGIGDFFEKSGVEEKRKYRKRDPKARILWDARC
HAGENREHLKLLARPKLHCPPNPPSFRKALGDYVTKFHQVKLGLARAMSTILGQEESYIETAFDLESGFDVAAMNRYPPNFESNGTMGLAEHTDPGFIIS
LIQDMDGGLQILTHQGNWVNVHIPCNAILIQLGDQLEVLTNGKYKSHIHRVLVGSYKTKRISLGTLHGPSIDKFVAPALEFVDETRCSGYLGMTYSGALE
ANDRYEIEVQSCIEQLRKII

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G60290 2-oxoglutarate (2OG) and Fe(II... Lus10018950 0 1
Lus10021406 1.4 0.9818
AT5G22860 Serine carboxypeptidase S28 fa... Lus10005354 1.7 0.9765
Lus10021407 2.8 0.9807
AT5G05340 Peroxidase superfamily protein... Lus10032786 2.8 0.9751
AT4G27290 S-locus lectin protein kinase ... Lus10014813 4.2 0.9584
AT2G47190 MYB AtMYB2 myb domain protein 2 (.1) Lus10009996 4.5 0.9728
AT1G16130 WAKL2 wall associated kinase-like 2 ... Lus10004504 6.5 0.9550
AT3G47570 Leucine-rich repeat protein ki... Lus10004388 6.6 0.9382
AT3G47570 Leucine-rich repeat protein ki... Lus10016896 6.7 0.9533
AT3G49780 ATPSK3(FORMERSY... phytosulfokine 4 precursor (.1... Lus10011721 6.9 0.9536

Lus10018950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.