Lus10018969 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G17540 46 / 6e-06 F-box and associated interaction domains-containing protein (.1)
AT3G17280 44 / 3e-05 F-box and associated interaction domains-containing protein (.1)
AT1G32420 42 / 7e-05 F-box and associated interaction domains-containing protein (.1)
AT2G07140 42 / 0.0001 F-box and associated interaction domains-containing protein (.1.2)
AT3G17570 42 / 0.0001 F-box and associated interaction domains-containing protein (.1)
AT3G24700 41 / 0.0002 F-box and associated interaction domains-containing protein (.1)
AT3G18340 41 / 0.0002 F-box and associated interaction domains-containing protein (.1)
AT1G11620 41 / 0.0003 F-box and associated interaction domains-containing protein (.1)
AT3G23880 40 / 0.0003 F-box and associated interaction domains-containing protein (.1)
AT2G27520 40 / 0.0005 F-box and associated interaction domains-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001105 106 / 3e-27 AT3G06240 109 / 3e-26 F-box family protein (.1)
Lus10018972 97 / 3e-23 AT5G36930 192 / 3e-51 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10009424 89 / 6e-21 AT3G06240 73 / 9e-14 F-box family protein (.1)
Lus10018095 84 / 5e-19 ND 49 / 4e-06
Lus10028961 83 / 1e-18 AT4G12560 81 / 2e-16 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Lus10023372 83 / 1e-18 AT3G16210 67 / 5e-12 F-box family protein (.1)
Lus10018008 82 / 3e-18 AT3G16210 82 / 6e-17 F-box family protein (.1)
Lus10015408 78 / 8e-17 AT3G16210 64 / 6e-11 F-box family protein (.1)
Lus10029725 77 / 2e-16 AT3G06240 74 / 3e-14 F-box family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G058000 64 / 4e-12 AT3G06240 138 / 5e-37 F-box family protein (.1)
Potri.001G318300 61 / 3e-11 AT3G06240 140 / 7e-38 F-box family protein (.1)
Potri.012G099733 56 / 3e-09 AT3G16210 92 / 2e-20 F-box family protein (.1)
Potri.017G058900 55 / 5e-09 AT3G06240 132 / 2e-34 F-box family protein (.1)
Potri.001G318400 55 / 7e-09 AT3G06240 142 / 3e-38 F-box family protein (.1)
Potri.007G074084 54 / 1e-08 AT1G11270 83 / 1e-17 F-box and associated interaction domains-containing protein (.1.2.3)
Potri.012G014700 51 / 1e-07 AT1G12170 66 / 1e-11 F-box family protein (.1)
Potri.014G162600 49 / 9e-07 AT3G07870 467 / 9e-164 F-box and associated interaction domains-containing protein (.1)
Potri.002G223000 48 / 1e-06 AT3G07870 467 / 5e-164 F-box and associated interaction domains-containing protein (.1)
Potri.008G199800 48 / 1e-06 AT3G23880 182 / 3e-53 F-box and associated interaction domains-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0271 F-box PF00646 F-box F-box domain
Representative CDS sequence
>Lus10018969 pacid=23149998 polypeptide=Lus10018969 locus=Lus10018969.g ID=Lus10018969.BGIv1.0 annot-version=v1.0
ATGAAGCGTTCTCGCAGCCACCGGAAGGAGAAAGCTGCTGCACGTTTACAGATCCAGAGAAGTCTGACGCAAAAAGTAGTCTCCGATCACCCTCAAAATA
ACTGCATTCTACCATCTGATATCATCACTGAAATCTTAAAGAGGCTTCCCGACGGCAGCACCATCGTTAGGCTCCGTCGCGTCTGCATTTCGTGGTATCG
CCTTCTCTCTGATCCTACTTTCATTCACTCCATTCTATCTTTCAGCTGCACAAACCCTAGTTCCGCAGACCACAAGGCCCAGATCCTAATTAAGGATAAA
CTCTACGGCACTGACGATGGCACTTACTACCGCGTCGTTTACACTTTGTTGTCTTATAACACTTTGAAGCCCATCAGCACGGTGTCCGCTCAGCAGCCCG
ATTTTCCCTGTGTTCTCGGCACGTCTTATATTGTACTAGGTCGAGGTTTGGATTTATCAATTGTGGGGTGTTGCGATGGGATAGTCTGCATTGCCGATAA
AATGGATGCAAGGGCCTCTGACATCATCCTATGGAATCCGTCCACTTCCGAAACCAAGATTTTGCCGTGTTCTCCCTGA
AA sequence
>Lus10018969 pacid=23149998 polypeptide=Lus10018969 locus=Lus10018969.g ID=Lus10018969.BGIv1.0 annot-version=v1.0
MKRSRSHRKEKAAARLQIQRSLTQKVVSDHPQNNCILPSDIITEILKRLPDGSTIVRLRRVCISWYRLLSDPTFIHSILSFSCTNPSSADHKAQILIKDK
LYGTDDGTYYRVVYTLLSYNTLKPISTVSAQQPDFPCVLGTSYIVLGRGLDLSIVGCCDGIVCIADKMDARASDIILWNPSTSETKILPCSP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G32420 F-box and associated interacti... Lus10018969 0 1
AT1G31040 PLATZ transcription factor fam... Lus10036226 1.0 0.9035
AT2G05760 Xanthine/uracil permease famil... Lus10035311 9.5 0.8755
AT3G22520 unknown protein Lus10041202 14.1 0.8805
AT4G03220 Protein with RNI-like/FBD-like... Lus10006970 15.7 0.8504
AT3G52110 unknown protein Lus10039611 16.6 0.8954
AT1G63640 P-loop nucleoside triphosphate... Lus10002007 17.6 0.8922
AT5G58230 MSI1, MEE70, AT... MATERNAL EFFECT EMBRYO ARREST ... Lus10033459 19.4 0.8707
AT1G77270 unknown protein Lus10038311 24.6 0.8678
Lus10018968 26.0 0.8210
AT3G21100 RNA-binding (RRM/RBD/RNP motif... Lus10027350 29.5 0.8711

Lus10018969 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.