Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033847 [exp] 224 / 1e-74 ND / Lus10018997 [exp] 223 / 2e-74 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G032900 [exp] 75 / 6e-17 ND / Potri.005G047000 [exp] 52 / 8e-09 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018970 pacid=23150001 polypeptide=Lus10018970 locus=Lus10018970.g ID=Lus10018970.BGIv1.0 annot-version=v1.0 ATGGAGCCTGCAATGGTGGACCACTACAGAGTTGAGCAGAAACTGCATCAGACTTCAGACCCGATTTACGATTTCTTGCAGAAAGTAGGGGAGATCATCA CCACAGTGCAGCACGAGGTTAGCACTCCCAAGTTCGGACCTTTCAATGCTGCTCAGTCGCACCACTCCCCTAAACATACAGGCTTCATTGACGGTAATCA TGGGGGCGAAAAGTGGCAGAGCTCAAATGGGCATGCCCACCAGAACGACTACAAGTATGAGGATTATTACTGGAAGCCAGCGATCTCATCGGAGCCAACA ATGTTCACAACCAATGGTGGATGGACTAGGCCAACCCAGAAGGCTTGGGCATCGCAGCCGGATTCAAAACTAATAATATCAACACAGCCATAG
AA sequence Show only first row Show all	>Lus10018970 pacid=23150001 polypeptide=Lus10018970 locus=Lus10018970.g ID=Lus10018970.BGIv1.0 annot-version=v1.0 MEPAMVDHYRVEQKLHQTSDPIYDFLQKVGEIITTVQHEVSTPKFGPFNAAQSHHSPKHTGFIDGNHGGEKWQSSNGHAHQNDYKYEDYYWKPAISSEPT MFTTNGGWTRPTQKAWASQPDSKLIISTQP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018970 [exp]	0	1
AT5G06540			Pentatricopeptide repeat (PPR)...		Lus10031424 [exp]	1.0	0.9166
AT1G50420	GRAS	SCL-3, SCL3	scarecrow-like 3 (.1)		Lus10016892 [exp]	1.4	0.9095
AT4G13750		EMB2597, NOV	NO VEIN, EMBRYO DEFECTIVE 2597...		Lus10022572 [exp]	3.0	0.9016
AT3G48010		ATCNGC16	cyclic nucleotide-gated channe...		Lus10042132 [exp]	3.2	0.8853
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10025413 [exp]	3.5	0.8952
AT1G02520		MDR8, ABCB11, P...	multi-drug resistance 8, ATP-b...		Lus10025032 [exp]	5.1	0.8458
AT2G44820			unknown protein		Lus10026825 [exp]	6.7	0.8600
AT2G34480			Ribosomal protein L18ae/LX fam...		Lus10023453 [exp]	7.7	0.8505
AT3G45070			P-loop containing nucleoside t...		Lus10003068 [exp]	9.4	0.8674
AT1G48320			Thioesterase superfamily prote...		Lus10036869 [exp]	9.5	0.8681

Compare expression of checked genes

Lus10018970 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.