Plant FIBer expression Database

Lus10018982 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05780 129 / 2e-39 Vacuolar ATPase assembly integral membrane protein VMA21-like domain (.1)
AT2G31710 114 / 8e-34 Vacuolar ATPase assembly integral membrane protein VMA21-like domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033833
[exp]
184 / 2e-61 AT1G05780 146 / 5e-47 Vacuolar ATPase assembly integral membrane protein VMA21-like domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G160500
[exp]
139 / 1e-43 AT1G05780 138 / 6e-44 Vacuolar ATPase assembly integral membrane protein VMA21-like domain (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09446 VMA21 VMA21-like domain
Representative CDS sequence
>Lus10018982 pacid=23149971 polypeptide=Lus10018982 locus=Lus10018982.g ID=Lus10018982.BGIv1.0 annot-version=v1.0
ATGTCAGGAGTGGTGCAGAAGTTCTTCATCACTTCAATGCTCATGTGGATGGCTCCCATTGCGATCCTGTATGCATTCAACCATAACTTGCTTCCCGGTA
ATCATGATTTTGTATCTCTTGATTTGTATGTTTTTTGCTTTCGGTTTTTCGAGCTTGTTTGGCTTTCCTGGGTGCTCAACCCAACTAACTATACATACAT
GGACATCAATCCGGGAACAGGTATAACTACAATGTCCCCGCATTCTCTGACGTTGGTGAGTGGATTTGTTGCTGTTATATCAGTGAATGTTGTGATTGCG
TTCTACATATGTATGGCAATGAGGGAACCCGTGGATAAACACGAGCCAGATCCTACATTTGTTGCTCTGGCTCAAGATAGCGTGACCAAACTCACCGGCG
GCAAAGCTGTTGTTGATTCTGCTGAATCTTCAAAGAAAGAGGAATAG
AA sequence
>Lus10018982 pacid=23149971 polypeptide=Lus10018982 locus=Lus10018982.g ID=Lus10018982.BGIv1.0 annot-version=v1.0
MSGVVQKFFITSMLMWMAPIAILYAFNHNLLPGNHDFVSLDLYVFCFRFFELVWLSWVLNPTNYTYMDINPGTGITTMSPHSLTLVSGFVAVISVNVVIA
FYICMAMREPVDKHEPDPTFVALAQDSVTKLTGGKAVVDSAESSKKEE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G05780 Vacuolar ATPase assembly integ... Lus10018982
[exp]
0 1
AT5G19151 unknown protein Lus10034040
[exp]
4.5 0.7019
AT1G12400 Nucleotide excision repair, TF... Lus10007001
[exp]
6.9 0.6826
AT3G45770 Polyketide synthase, enoylredu... Lus10020161
[exp]
9.6 0.7307
AT1G51740 ATSYP81, SYP81,... ORTHOLOG OF YEAST UFE1 \(UNKNO... Lus10028252
[exp]
23.5 0.6315
AT4G26310 elongation factor P (EF-P) fam... Lus10030360
[exp]
26.3 0.7015
AT4G21720 unknown protein Lus10017512
[exp]
34.8 0.6687
AT3G18110 EMB1270 embryo defective 1270, Pentatr... Lus10013785
[exp]
37.5 0.6444
AT4G08980 FBW2 F-BOX WITH WD-40 2 (.1.2.3.4.5... Lus10010351
[exp]
42.9 0.6734
AT3G60910 S-adenosyl-L-methionine-depend... Lus10016376
[exp]
44.6 0.5966
AT5G11900 Translation initiation factor ... Lus10013512
[exp]
49.0 0.6371

Lus10018982 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.