Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48930 62 / 4e-13 HCT hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) AT2G19070 47 / 1e-07 SHT spermidine hydroxycinnamoyl transferase (.1) AT3G48720 44 / 1e-06 DCF DEFICIENT IN CUTIN FERULATE, HXXXD-type acyl-transferase family protein (.1) AT5G63560 41 / 1e-05 HXXXD-type acyl-transferase family protein (.1) AT5G41040 40 / 2e-05 HXXXD-type acyl-transferase family protein (.1.2) AT5G57840 39 / 9e-05 HXXXD-type acyl-transferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037266 [exp] 67 / 1e-14 AT5G48930 365 / 4e-123 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Lus10005358 [exp] 59 / 6e-12 AT2G19070 471 / 2e-164 spermidine hydroxycinnamoyl transferase (.1) Lus10001282 [exp] 58 / 2e-11 AT2G19070 501 / 3e-175 spermidine hydroxycinnamoyl transferase (.1) Lus10010786 [exp] 57 / 4e-11 AT5G48930 451 / 5e-157 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Lus10022163 [exp] 55 / 1e-10 AT5G48930 449 / 2e-156 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Lus10021394 [exp] 54 / 4e-10 AT2G19070 466 / 4e-162 spermidine hydroxycinnamoyl transferase (.1) Lus10026097 [exp] 53 / 1e-09 AT5G48930 599 / 0.0 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Lus10026123 [exp] 52 / 2e-09 AT5G48930 597 / 0.0 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Lus10002321 [exp] 52 / 2e-09 AT5G48930 639 / 0.0 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G105500 [exp] 66 / 2e-14 AT5G48930 556 / 0.0 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Potri.005G028000 [exp] 61 / 2e-12 AT5G48930 504 / 6e-178 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Potri.001G042900 [exp] 60 / 2e-12 AT5G48930 749 / 0.0 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Potri.003G183900 [exp] 60 / 2e-12 AT5G48930 758 / 0.0 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Potri.018G104700 [exp] 60 / 3e-12 AT5G48930 489 / 5e-172 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Potri.005G028100 [exp] 58 / 1e-11 AT5G48930 509 / 5e-180 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Potri.014G166600 [exp] 48 / 4e-08 AT5G41040 394 / 2e-134 HXXXD-type acyl-transferase family protein (.1.2) Potri.018G109900 [exp] 47 / 1e-07 AT2G19070 563 / 0.0 spermidine hydroxycinnamoyl transferase (.1) Potri.006G165200 [exp] 44 / 1e-06 AT2G19070 595 / 0.0 spermidine hydroxycinnamoyl transferase (.1) Potri.015G100800 [exp] 44 / 1e-06 AT5G41040 644 / 0.0 HXXXD-type acyl-transferase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0149 [flax] [poplar] CoA-acyltrans PF02458 [flax] [poplar] Transferase Transferase family
Representative CDS sequence Show only first row Show all	>Lus10018983 pacid=23149983 polypeptide=Lus10018983 locus=Lus10018983.g ID=Lus10018983.BGIv1.0 annot-version=v1.0 ATGGTATCAGACGGTGTATCAACACTCAACTTCTTTAACACTTGGGCACTGATTGCTTGCGGTCTTGCAACCACCACGACCCCGTTTCTTGACCGCATCA TCCTCAAAGCTGGACAACTTGCAACCCCAAAGTTTCACCACACCAAATACGACCCTCGTCCTACCATGATCCTTCCGGTACTAGAAGAAGGGAGGCCTAT TGTGATCTGA
AA sequence Show only first row Show all	>Lus10018983 pacid=23149983 polypeptide=Lus10018983 locus=Lus10018983.g ID=Lus10018983.BGIv1.0 annot-version=v1.0 MVSDGVSTLNFFNTWALIACGLATTTTPFLDRIILKAGQLATPKFHHTKYDPRPTMILPVLEEGRPIVI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G48930		HCT	hydroxycinnamoyl-CoA shikimate...		Lus10018983 [exp]	0	1
AT3G06830			Plant invertase/pectin methyle...		Lus10000034 [exp]	13.0	0.7417
AT1G18010			Major facilitator superfamily ...		Lus10009416 [exp]	22.8	0.7490
AT1G79860		ATROPGEF12, ROP...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10038560 [exp]	57.1	0.7283
AT5G20690			Leucine-rich repeat protein ki...		Lus10013165 [exp]	60.0	0.6805
AT2G37430	C2H2ZnF	ZAT11	C2H2 and C2HC zinc fingers sup...		Lus10040312 [exp]	88.4	0.7278
AT5G43680			unknown protein		Lus10004356 [exp]	100.2	0.7020
AT4G18210		ATPUP10	purine permease 10 (.1)		Lus10008689 [exp]	104.3	0.6903
AT1G71160		KCS7	3-ketoacyl-CoA synthase 7 (.1)		Lus10031486 [exp]	106.5	0.6552
AT2G04350		LACS8	long-chain acyl-CoA synthetase...		Lus10012307 [exp]	126.2	0.7115
AT3G47440		TIP5;1	tonoplast intrinsic protein 5;...		Lus10031157 [exp]	147.8	0.6817

Compare expression of checked genes

Lus10018983 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.