Lus10018986 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25050 136 / 2e-42 ACP4 acyl carrier protein 4 (.1.2)
AT1G54580 128 / 5e-39 ACP2 acyl carrier protein 2 (.1)
AT1G54630 127 / 7e-39 ACP3 acyl carrier protein 3 (.1.2)
AT3G05020 123 / 4e-37 ACP1 acyl carrier protein 1 (.1)
AT5G27200 121 / 3e-36 ACP5 acyl carrier protein 5 (.1)
AT1G65290 54 / 5e-10 MTACP2 mitochondrial acyl carrier protein 2 (.1)
AT2G44620 45 / 6e-07 MTACP1, MTACP-1 mitochondrial acyl carrier protein 1 (.1)
AT5G47630 40 / 9e-05 MTACP3 mitochondrial acyl carrier protein 3 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033836 250 / 2e-87 AT4G25050 137 / 2e-42 acyl carrier protein 4 (.1.2)
Lus10038636 136 / 2e-42 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2)
Lus10038635 136 / 2e-42 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2)
Lus10037908 136 / 3e-42 AT4G25050 132 / 8e-41 acyl carrier protein 4 (.1.2)
Lus10037910 135 / 5e-42 AT4G25050 130 / 4e-40 acyl carrier protein 4 (.1.2)
Lus10020221 53 / 1e-09 AT1G65290 183 / 4e-61 mitochondrial acyl carrier protein 2 (.1)
Lus10026849 54 / 4e-09 AT1G08450 590 / 0.0 PRIORITY IN SWEET LIFE 1, EMS-MUTAGENIZED BRI1 SUPPRESSOR 2, A. thaliana calreticulin 3, calreticulin 3 (.1.2.3)
Lus10019500 51 / 5e-09 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1)
Lus10043348 51 / 5e-09 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G031300 175 / 1e-57 AT3G05020 142 / 1e-44 acyl carrier protein 1 (.1)
Potri.005G044800 172 / 2e-56 AT5G27200 146 / 5e-46 acyl carrier protein 5 (.1)
Potri.015G104500 138 / 5e-43 AT4G25050 122 / 2e-36 acyl carrier protein 4 (.1.2)
Potri.012G105300 138 / 6e-43 AT4G25050 107 / 8e-31 acyl carrier protein 4 (.1.2)
Potri.006G217800 98 / 6e-27 AT1G54630 94 / 2e-25 acyl carrier protein 3 (.1.2)
Potri.013G084500 53 / 1e-09 AT1G65290 188 / 5e-63 mitochondrial acyl carrier protein 2 (.1)
Potri.019G055300 52 / 2e-09 AT1G65290 196 / 6e-66 mitochondrial acyl carrier protein 2 (.1)
Potri.014G044000 47 / 1e-07 AT2G44620 163 / 2e-53 mitochondrial acyl carrier protein 1 (.1)
Potri.006G005700 44 / 3e-06 AT5G47630 107 / 5e-31 mitochondrial acyl carrier protein 3 (.1.2)
Potri.016G006300 43 / 6e-06 AT5G47630 111 / 1e-32 mitochondrial acyl carrier protein 3 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0314 PP-binding PF00550 PP-binding Phosphopantetheine attachment site
Representative CDS sequence
>Lus10018986 pacid=23149997 polypeptide=Lus10018986 locus=Lus10018986.g ID=Lus10018986.BGIv1.0 annot-version=v1.0
ATGGCGGCTGCTTCTTCTTCCTTCATCTCCCTCAACTCTCGCCCTACTCCGGGCCTGAGCAGGATCTCCGGCGTCAAATTGGCTTCAAATCAGGGAGTTG
TGTCCTTTGGCCGGCGTCCAGCTCGTCTCCGGATCTCCTGCGCCGCTAAGCCTGATACGGTGGAGAAGGTATGCACCATCGTGAAGAAGCAGCTGGCGCT
GTCCCCGGAGACCGTCGTGACCGGCGAATCAAAGTTCTCAGCACTTGGTGCCGATTCGCTCGACACGGTTGAAATCGTGATGGGGCTTGAAGAGGAATTC
GGGATCAACGTCGAAGAGGAGAGTGCTCAGTCCATAGCCACAGTTCAAGACGCTGCTGACCTTATCGAAGACCTTGTTGAGAAGAAAGCTTGA
AA sequence
>Lus10018986 pacid=23149997 polypeptide=Lus10018986 locus=Lus10018986.g ID=Lus10018986.BGIv1.0 annot-version=v1.0
MAAASSSFISLNSRPTPGLSRISGVKLASNQGVVSFGRRPARLRISCAAKPDTVEKVCTIVKKQLALSPETVVTGESKFSALGADSLDTVEIVMGLEEEF
GINVEEESAQSIATVQDAADLIEDLVEKKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25050 ACP4 acyl carrier protein 4 (.1.2) Lus10018986 0 1
AT4G17486 PPPDE putative thiol peptidase... Lus10013657 1.4 0.9358
AT3G53990 Adenine nucleotide alpha hydro... Lus10022602 3.3 0.9420
AT4G30200 VEL1, VIL2 VIN3-Like 2, vernalization5/VI... Lus10038260 3.5 0.9338
AT5G08100 ASPGA1 asparaginase A1, N-terminal nu... Lus10034668 4.5 0.9297
AT1G67550 URE urease (.1) Lus10015814 7.7 0.9218
AT1G71740 unknown protein Lus10042773 8.5 0.9296
AT2G15730 P-loop containing nucleoside t... Lus10021749 10.1 0.8812
AT5G42180 PER64 peroxidase 64, Peroxidase supe... Lus10034547 10.4 0.9232
AT5G25140 CYP71B13 "cytochrome P450, family 71, s... Lus10018263 11.1 0.9320
AT4G00460 ATROPGEF3, ROPG... RHO guanyl-nucleotide exchange... Lus10036353 15.2 0.8995

Lus10018986 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.