Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G67490 69 / 3e-16 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000389 [exp] 150 / 2e-48 AT5G67490 69 / 3e-16 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G017700 [exp] 67 / 2e-15 AT5G67490 64 / 2e-14 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07896 [flax] [poplar] DUF1674 Protein of unknown function (DUF1674)
Representative CDS sequence Show only first row Show all	>Lus10019019 pacid=23152709 polypeptide=Lus10019019 locus=Lus10019019.g ID=Lus10019019.BGIv1.0 annot-version=v1.0 ATGGCGAGAACCAATCTCAGGTGTTTATTCTCATCGATCTCCGATCTCGCCGCAGTCAGATTCGACCCGGATATCAAGGTTAACGCCGCTTCCAACACCC TGCGCAGGCTCTTGAGCTCCACGACGACTCACCAATCGGAGCTGGACCATACGAGCGATCGGAATCCGAGTGCTGATCCTGAAAGCGAGAAGAGATCGAA GGAACAAGAGGCGGTGGATGAAGAGGAAGATGGGGACGAATATGGAGTTAACAAGGAGACGGGAGAGATCGGCGGTCCGAGAGGTCCCGAGCCCACTAGG TACGGCGATTGGGAGCAAAAAGGCCGATGCTCCGATTTCTGA
AA sequence Show only first row Show all	>Lus10019019 pacid=23152709 polypeptide=Lus10019019 locus=Lus10019019.g ID=Lus10019019.BGIv1.0 annot-version=v1.0 MARTNLRCLFSSISDLAAVRFDPDIKVNAASNTLRRLLSSTTTHQSELDHTSDRNPSADPESEKRSKEQEAVDEEEDGDEYGVNKETGEIGGPRGPEPTR YGDWEQKGRCSDF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G67490			unknown protein		Lus10019019 [exp]	0	1
AT5G12190			RNA-binding (RRM/RBD/RNP motif...		Lus10026814 [exp]	3.6	0.7896
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Lus10011816 [exp]	4.5	0.7863
AT3G05030		ATNHX2, NHX2	sodium hydrogen exchanger 2 (....		Lus10018989 [exp]	7.7	0.7570
AT4G15930			Dynein light chain type 1 fami...		Lus10006500 [exp]	8.3	0.7745
AT3G51850		CPK13	calcium-dependent protein kina...		Lus10027808 [exp]	8.7	0.7533
AT3G05100			S-adenosyl-L-methionine-depend...		Lus10033850 [exp]	10.2	0.7712
AT3G51850		CPK13	calcium-dependent protein kina...		Lus10004807 [exp]	15.9	0.7678
AT2G15910			CSL zinc finger domain-contain...		Lus10023841 [exp]	18.8	0.7560
AT1G48440			B-cell receptor-associated 31-...		Lus10040126 [exp]	19.0	0.7586
AT3G05545			RING/U-box superfamily protein...		Lus10029886 [exp]	20.4	0.7584

Compare expression of checked genes

Lus10019019 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.