Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33550 99 / 4e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G30880 82 / 2e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G32280 63 / 5e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G56480 61 / 5e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G13295 37 / 0.0005 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005010 [exp] 145 / 7e-47 AT4G33550 89 / 8e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10019770 [exp] 78 / 1e-19 AT4G30880 98 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10016357 [exp] 68 / 7e-16 AT4G30880 94 / 4e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10019030 [exp] 66 / 8e-15 AT4G33550 79 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10027345 [exp] 64 / 3e-14 AT4G33550 81 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10005011 [exp] 64 / 4e-14 AT4G33550 78 / 1e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G049300 [exp] 90 / 3e-24 AT4G33550 81 / 6e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G023200 [exp] 86 / 7e-23 AT4G30880 115 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G023300 [exp] 86 / 1e-22 AT4G30880 99 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G048900 [exp] 76 / 5e-19 AT4G30880 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G049000 [exp] 74 / 3e-18 AT4G30880 75 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G048800 [exp] 61 / 1e-12 AT4G33550 72 / 5e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G084000 [exp] 45 / 8e-07 AT4G33550 54 / 1e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10019029 pacid=23152675 polypeptide=Lus10019029 locus=Lus10019029.g ID=Lus10019029.BGIv1.0 annot-version=v1.0 ATGGCGGGTGTAAGTACTGGTTGCAGGCTACTGCTAGTACTAGTACTAGTACTGATCGGTACTAGCACTCAGCAGCATCAAGCTTTGGCGCAGAGTTACT GCAACGCGCCCCTCATGTCCCTGATGTCGTGCTGGAAGTACGTCCAGAAATCCGGAGCCAAGTCACCGCCCTCGCCCGATTGCTGCACCGCCATCAAGCC GGTCGACGTGTCCTGCGCTTGCGGCTACGTCAGCAAGTCCGTCGAGGGCTACGTCAGCATGGATAAGGTCGTTTACGTCGCCCGCTCCTGCGGCAAGACC CTCGCCGCCGGTACCAAGTGTGGCAGTTATACTATTCCTCCGCCGTGA
AA sequence Show only first row Show all	>Lus10019029 pacid=23152675 polypeptide=Lus10019029 locus=Lus10019029.g ID=Lus10019029.BGIv1.0 annot-version=v1.0 MAGVSTGCRLLLVLVLVLIGTSTQQHQALAQSYCNAPLMSLMSCWKYVQKSGAKSPPSPDCCTAIKPVDVSCACGYVSKSVEGYVSMDKVVYVARSCGKT LAAGTKCGSYTIPPP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33550			Bifunctional inhibitor/lipid-t...		Lus10019029 [exp]	0	1
AT3G52790			peptidoglycan-binding LysM dom...		Lus10027407 [exp]	1.0	0.9943
AT1G08170			Histone superfamily protein (....		Lus10041351 [exp]	1.4	0.9906
AT3G56850	bZIP	DPBF3, AREB3	ABA-responsive element binding...		Lus10028888 [exp]	1.7	0.9804
AT5G17820			Peroxidase superfamily protein...		Lus10013631 [exp]	3.2	0.9606
AT4G21200		ATGA2OX8	ARABIDOPSIS THALIANA GIBBERELL...		Lus10007640 [exp]	4.0	0.9664
AT3G53720		ATCHX20	cation/H+ exchanger 20, cation...		Lus10025325 [exp]	4.7	0.9320
AT5G05960			Bifunctional inhibitor/lipid-t...		Lus10009872 [exp]	5.3	0.9456
AT5G24620			Pathogenesis-related thaumatin...		Lus10023896 [exp]	5.5	0.9496
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10024584 [exp]	5.7	0.9420
AT3G18280			Bifunctional inhibitor/lipid-t...		Lus10013030 [exp]	8.4	0.9330

Compare expression of checked genes

Lus10019029 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.