Lus10019040 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024904 150 / 2e-42 AT1G57790 97 / 2e-21 F-box family protein (.1)
Lus10013738 135 / 4e-39 AT1G57790 73 / 3e-14 F-box family protein (.1)
Lus10013731 103 / 3e-27 AT1G17860 172 / 5e-53 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10029943 58 / 4e-10 AT1G57790 81 / 4e-16 F-box family protein (.1)
Lus10004476 55 / 4e-09 AT1G57790 92 / 4e-20 F-box family protein (.1)
Lus10035341 52 / 2e-08 ND /
Lus10022706 40 / 0.0003 AT1G57790 293 / 3e-97 F-box family protein (.1)
Lus10019204 39 / 0.0007 AT1G57790 79 / 2e-16 F-box family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G106800 81 / 4e-18 AT1G57790 99 / 6e-23 F-box family protein (.1)
Potri.005G105400 39 / 0.0008 AT1G65770 148 / 8e-41 ascorbic acid mannose pathway regulator 1 (.1)
PFAM info
Representative CDS sequence
>Lus10019040 pacid=23152703 polypeptide=Lus10019040 locus=Lus10019040.g ID=Lus10019040.BGIv1.0 annot-version=v1.0
ATGGGGATATTCGATCCGAAGAAGAAGAGGAGCGAGAACATGTGGAGGATACTCGATGTAAAATCACATCGCGCTTTTTCCACGAGCTGTTATAATCAAT
CTTACTTGATGGAATCTAGCCAATCCGGAGAGCGGATTTCAGTCCTGGTTGGATGGTACGGGGAATTCGTTAGGGTTTTCAAGTTCAACGGACACATGAG
GCTATGGCAGAGTGTTTCTAGTCTCGGAGATCAAGTGGCTTGCTTGAGTGGCACGTCATCGATGATCCTGTCCTGCCGTGAGCTGCAAGTTAAGGGATTG
GAGAACACCATCCATTTTGCAAGGTTTGACGACGTTGGTAACTACAACGTGTTCTACTCGCTTTCGACTGGGAAATTTCACTCTGTTAAGAATGGATACA
CTTCGTACAACTTGTTAGATACCCAACTTTACTTGAACACTACTGGATTGATTTGGATAACCATGGACGATCATGAACTTGCGGTTGATAACTAA
AA sequence
>Lus10019040 pacid=23152703 polypeptide=Lus10019040 locus=Lus10019040.g ID=Lus10019040.BGIv1.0 annot-version=v1.0
MGIFDPKKKRSENMWRILDVKSHRAFSTSCYNQSYLMESSQSGERISVLVGWYGEFVRVFKFNGHMRLWQSVSSLGDQVACLSGTSSMILSCRELQVKGL
ENTIHFARFDDVGNYNVFYSLSTGKFHSVKNGYTSYNLLDTQLYLNTTGLIWITMDDHELAVDN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10019040 0 1
Lus10003753 10.5 0.5774
AT4G20040 Pectin lyase-like superfamily ... Lus10008700 14.9 0.5774
AT3G11480 BSMT1, ATBSMT1 S-adenosyl-L-methionine-depend... Lus10041381 15.5 0.5760
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10000682 18.2 0.5774
AT3G52970 CYP76G1 "cytochrome P450, family 76, s... Lus10032339 21.1 0.5774
AT3G14250 RING/U-box superfamily protein... Lus10022064 24.6 0.5329
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10013920 30.9 0.5160
AT2G16730 BGAL13 beta-galactosidase 13, glycosy... Lus10014126 31.9 0.5160
Lus10017767 32.0 0.5602
AT5G45670 GDSL-like Lipase/Acylhydrolase... Lus10015241 33.0 0.5160

Lus10019040 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.