Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019050 pacid=23152701 polypeptide=Lus10019050 locus=Lus10019050.g ID=Lus10019050.BGIv1.0 annot-version=v1.0 ATGAAGGCAAGACAGTATAAGAAGACTGATGTTACTACACCTAAGAGAAAATGGGTAGTGAAATCTGTTCCAGCTCCCACATTGGAGTTAATTGAACCTA TGGGTGCCACTGTATCTAGTCCTTCGAAGGGAGGTGAGACTCCTAGTCTGGTTGCTGACTCTGTAGTAGTTGAGGACATCCCTGAGGACTCTGTTGTGCT GTCAATGCCCCCTGCTTACCAGAAGGATGTGTGA
AA sequence Show only first row Show all	>Lus10019050 pacid=23152701 polypeptide=Lus10019050 locus=Lus10019050.g ID=Lus10019050.BGIv1.0 annot-version=v1.0 MKARQYKKTDVTTPKRKWVVKSVPAPTLELIEPMGATVSSPSKGGETPSLVADSVVVEDIPEDSVVLSMPPAYQKDV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10019050 [exp]	0	1
AT3G14940		ATPPC3	phosphoenolpyruvate carboxylas...		Lus10000065 [exp]	4.9	0.8790
AT4G38200			SEC7-like guanine nucleotide e...		Lus10001620 [exp]	6.0	0.8979
AT5G47490			RGPR-related (.1)		Lus10007471 [exp]	13.6	0.8950
AT1G22610			C2 calcium/lipid-binding plant...		Lus10009460 [exp]	15.6	0.8739
AT5G47490			RGPR-related (.1)		Lus10028946 [exp]	17.1	0.8858
AT4G38200			SEC7-like guanine nucleotide e...		Lus10022983 [exp]	18.8	0.8838
AT5G47940			unknown protein		Lus10016406 [exp]	21.8	0.8369
AT1G48840			Plant protein of unknown funct...		Lus10026581 [exp]	23.1	0.8224
AT4G03560		FOU2, ATCCH1, A...	FATTY ACID OXYGENATION UPREGUL...		Lus10039829 [exp]	23.2	0.8344
AT3G60920			unknown protein		Lus10009306 [exp]	25.8	0.8805

Compare expression of checked genes

Lus10019050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.