Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031024 [exp] 90 / 2e-24 AT1G48120 58 / 1e-09 hydrolases;protein serine/threonine phosphatases (.1) Lus10017017 [exp] 77 / 5e-20 AT1G48120 40 / 9e-05 hydrolases;protein serine/threonine phosphatases (.1) Lus10029535 [exp] 75 / 8e-19 AT1G48120 50 / 1e-07 hydrolases;protein serine/threonine phosphatases (.1) Lus10019062 [exp] 72 / 1e-17 ND / Lus10003407 [exp] 72 / 8e-17 AT1G30450 1520 / 0.0 HAPLESS 5, cation-chloride co-transporter 1 (.1.2.3) Lus10034854 [exp] 69 / 2e-16 AT1G48120 69 / 3e-14 hydrolases;protein serine/threonine phosphatases (.1) Lus10032884 [exp] 60 / 2e-13 ND / Lus10039412 [exp] 54 / 9e-11 ND / Lus10015061 [exp] 53 / 2e-10 ND 45 / 3e-06
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019051 pacid=23152712 polypeptide=Lus10019051 locus=Lus10019051.g ID=Lus10019051.BGIv1.0 annot-version=v1.0 ATGTACAACAAGAGTCGGATGTTATCGCTTCCAAAGTACAGACAGCTGTTCGATGAGGGCACACCGTTCATGTGGGTCCCCTACTACGACCGTGAGGATT GGGCACACTCTGCTTCTGCATACAGGGTCATTGTCCCACAGATTTCTCTCCGCAACATCTCTTGGCATCGACCAGACCGTGTACTCAGATAG
AA sequence Show only first row Show all	>Lus10019051 pacid=23152712 polypeptide=Lus10019051 locus=Lus10019051.g ID=Lus10019051.BGIv1.0 annot-version=v1.0 MYNKSRMLSLPKYRQLFDEGTPFMWVPYYDREDWAHSASAYRVIVPQISLRNISWHRPDRVLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10019051 [exp]	0	1
AT1G17930			Aminotransferase-like, plant m...		Lus10001981 [exp]	3.2	1.0000
AT4G13420		HAK5, ATHAK5	high affinity K+ transporter 5...		Lus10005194 [exp]	4.7	1.0000
					Lus10027667 [exp]	5.5	1.0000
					Lus10015682 [exp]	6.3	1.0000
AT4G18340			Glycosyl hydrolase superfamily...		Lus10031034 [exp]	7.1	1.0000
AT2G14378			Protein of unknown function (D...		Lus10019101 [exp]	8.1	1.0000
AT1G29430			SAUR-like auxin-responsive pro...		Lus10020431 [exp]	8.8	1.0000
AT3G20800			Cell differentiation, Rcd1-lik...		Lus10015136 [exp]	9.4	0.8506
AT1G14290		SBH2	sphingoid base hydroxylase 2 (...		Lus10036293 [exp]	9.4	1.0000
					Lus10040407 [exp]	9.9	1.0000

Compare expression of checked genes

Lus10019051 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.