Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31985 100 / 1e-29 Ribosomal protein L39 family protein (.1) AT3G02190 99 / 3e-29 Ribosomal protein L39 family protein (.1) AT2G25210 87 / 3e-24 Ribosomal protein L39 family protein (.1) AT5G50460 54 / 4e-11 secE/sec61-gamma protein transport protein (.1) AT4G24920 54 / 4e-11 secE/sec61-gamma protein transport protein (.1) AT3G48570 49 / 5e-09 secE/sec61-gamma protein transport protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002220 [exp] 101 / 6e-30 ND 99 / 1e-29 Lus10041552 [exp] 61 / 3e-13 AT5G50460 127 / 4e-40 secE/sec61-gamma protein transport protein (.1) Lus10012539 [exp] 61 / 3e-13 AT5G50460 127 / 4e-40 secE/sec61-gamma protein transport protein (.1) Lus10035206 [exp] 60 / 3e-13 AT5G50460 127 / 1e-40 secE/sec61-gamma protein transport protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G022100 [exp] 97 / 3e-28 AT4G31985 98 / 1e-29 Ribosomal protein L39 family protein (.1) Potri.018G112301 [exp] 97 / 3e-28 AT4G31985 98 / 1e-29 Ribosomal protein L39 family protein (.1) Potri.006G260500 [exp] 97 / 3e-28 AT4G31985 98 / 1e-29 Ribosomal protein L39 family protein (.1) Potri.006G260837 [exp] 97 / 3e-28 AT4G31985 98 / 1e-29 Ribosomal protein L39 family protein (.1) Potri.006G188500 [exp] 97 / 3e-28 AT4G31985 98 / 1e-29 Ribosomal protein L39 family protein (.1) Potri.001G329400 [exp] 58 / 9e-13 AT5G50460 99 / 2e-29 secE/sec61-gamma protein transport protein (.1) Potri.015G097300 [exp] 57 / 3e-12 AT5G50460 103 / 3e-31 secE/sec61-gamma protein transport protein (.1) Potri.012G098400 [exp] 57 / 3e-12 AT5G50460 104 / 2e-31 secE/sec61-gamma protein transport protein (.1) Potri.017G064032 [exp] 46 / 5e-08 AT5G50460 101 / 4e-30 secE/sec61-gamma protein transport protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00832 [flax] [poplar] Ribosomal_L39 Ribosomal L39 protein
Representative CDS sequence Show only first row Show all	>Lus10019065 pacid=23152663 polypeptide=Lus10019065 locus=Lus10019065.g ID=Lus10019065.BGIv1.0 annot-version=v1.0 ATGGACACCATTGACAACGTCTTCGATCCGCTCAAGGAATTCACTAAGGATAGCGTCCGCCTTGTCAAGCGTTGCCGCAAACCCGAATGGAAAGAATTTT TCAAGGGTGTGGAAGGAGATAGGGGTTGTTGTGATGGGCCGTCGCACAAGTCGTTCATGATCAAGAAGAAACTGGCGAAGAAGATGAGGCAGAACAGGCC GATCCCCAACTGGATCAGGTTGAGGACAGACAACACCATCAGGTACAATGCTAAGCGCAGGCACTGGCGCCGTACCAAGCTAGGGTTCTAA
AA sequence Show only first row Show all	>Lus10019065 pacid=23152663 polypeptide=Lus10019065 locus=Lus10019065.g ID=Lus10019065.BGIv1.0 annot-version=v1.0 MDTIDNVFDPLKEFTKDSVRLVKRCRKPEWKEFFKGVEGDRGCCDGPSHKSFMIKKKLAKKMRQNRPIPNWIRLRTDNTIRYNAKRRHWRRTKLGF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G31985			Ribosomal protein L39 family p...		Lus10019065 [exp]	0	1
AT5G23710			DNA binding;DNA-directed RNA p...		Lus10003505 [exp]	3.5	0.8209
AT2G27530		PGY1	PIGGYBACK1, Ribosomal protein ...		Lus10004871 [exp]	3.9	0.8434
AT2G20060			Ribosomal protein L4/L1 family...		Lus10005427 [exp]	5.9	0.7837
AT3G12150			unknown protein		Lus10035501 [exp]	6.8	0.8280
AT2G03510			SPFH/Band 7/PHB domain-contain...		Lus10004648 [exp]	9.2	0.8036
AT5G24510			60S acidic ribosomal protein f...		Lus10002680 [exp]	11.3	0.7817
AT2G42710			Ribosomal protein L1p/L10e fam...		Lus10036988 [exp]	14.9	0.7721
AT5G62050		ATOXA1, OXA1AT,...	HOMOLOG OF YEAST OXIDASE ASSEM...		Lus10032381 [exp]	15.3	0.7908
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10043405 [exp]	19.3	0.7809
AT5G10360		RPS6B, EMB3010	Ribosomal protein small subuni...		Lus10020794 [exp]	20.0	0.8074

Compare expression of checked genes

Lus10019065 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.