Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60230 133 / 1e-39 ATSEN2, SEN2 splicing endonuclease 2 (.1.2) AT3G45590 115 / 5e-33 ATSEN1 splicing endonuclease 1 (.1.2) AT3G45577 74 / 6e-18 tRNA-intron endonucleases (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036866 [exp] 216 / 7e-72 AT5G60230 248 / 2e-82 splicing endonuclease 2 (.1.2) Lus10006218 [exp] 214 / 8e-68 AT5G60230 251 / 4e-80 splicing endonuclease 2 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G131500 [exp] 138 / 1e-41 AT5G60230 290 / 2e-99 splicing endonuclease 2 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0476 [flax] [poplar] tRNA-IECD_N PF02778 [flax] [poplar] tRNA_int_endo_N tRNA intron endonuclease, N-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10019074 pacid=23152708 polypeptide=Lus10019074 locus=Lus10019074.g ID=Lus10019074.BGIv1.0 annot-version=v1.0 ATGTCGCCGAGATGGAAAGGCAAAGGAGCCGAGGCAAAAGCTCTGGCAAATCCCATGTCTGAAACAGTCTCAAAGCTTCAATTTTGTCTCCTTCAAGCAG ACGCTCACAACTCACTCATAGGAATCACCGTGCTCCTACCAGTTGAACCATGCCAAGCTGAGCTTCTCAACCGGACCTGCTTTTGCCCACCCATCACGAC AGCCGACAAAGACTATAAGAAATTGTTTCGGCTATCTCTCGAGGAAGCATTCTATCTCTGCCATTCTTTGAAATGCCTCACAATCAGCAAAGGCAGCACT TATCTGTTAACTGTTGAGGAGCTATGGAAATACATGAAGTCCAAGGTACCGAACTTCCCTGTTTTCTACAAAGCTTATTCCCATCTATGA
AA sequence Show only first row Show all	>Lus10019074 pacid=23152708 polypeptide=Lus10019074 locus=Lus10019074.g ID=Lus10019074.BGIv1.0 annot-version=v1.0 MSPRWKGKGAEAKALANPMSETVSKLQFCLLQADAHNSLIGITVLLPVEPCQAELLNRTCFCPPITTADKDYKKLFRLSLEEAFYLCHSLKCLTISKGST YLLTVEELWKYMKSKVPNFPVFYKAYSHL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G60230		ATSEN2, SEN2	splicing endonuclease 2 (.1.2)		Lus10019074 [exp]	0	1
AT4G26140		BGAL12	beta-galactosidase 12 (.1.2)		Lus10040557 [exp]	1.0	0.9791
AT1G03090		MCCA	methylcrotonyl-CoA carboxylase...		Lus10042623 [exp]	3.2	0.9574
AT5G27830			unknown protein		Lus10029881 [exp]	4.6	0.9511
AT5G56550		ATOXS3	oxidative stress 3 (.1)		Lus10038265 [exp]	4.6	0.9391
AT3G45300		IVDH, ATIVD, IV...	isovaleryl-CoA-dehydrogenase (...		Lus10036122 [exp]	4.9	0.9487
AT1G55510		BCDH BETA1, BCD...	branched-chain alpha-keto acid...		Lus10013401 [exp]	5.0	0.9436
AT4G28240			Wound-responsive family protei...		Lus10031617 [exp]	6.2	0.9118
AT4G24800		ECIP1	EIN2 C-terminus Interacting Pr...		Lus10018085 [exp]	6.5	0.9419
AT1G60140		ATTPS10	TREHALOSE PHOSPHATE SYNTHASE 1...		Lus10030853 [exp]	7.5	0.9383
AT1G10600		AMSH2	associated molecule with the S...		Lus10030875 [exp]	7.9	0.9348

Compare expression of checked genes

Lus10019074 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.