Lus10019080 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G61400 159 / 5e-45 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G38730 75 / 3e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G64320 73 / 2e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G39710 71 / 9e-14 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G55840 68 / 6e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G48810 68 / 7e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G05670 67 / 2e-12 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
AT1G09680 66 / 4e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G20090 64 / 1e-11 EMB1025 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G61990 64 / 1e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015717 404 / 1e-144 AT5G61400 151 / 4e-42 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10008185 78 / 4e-16 AT1G19290 864 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10027974 76 / 2e-15 AT1G19290 480 / 1e-156 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013077 74 / 7e-15 AT5G40400 587 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10032174 70 / 1e-13 AT5G38730 746 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10034421 69 / 3e-13 AT2G02150 706 / 0.0 EMBRYO DEFECTIVE 2794, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10038804 68 / 6e-13 AT5G64320 367 / 3e-115 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10039056 68 / 7e-13 AT5G64320 832 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10026465 67 / 2e-12 AT1G05670 197 / 6e-55 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G015900 73 / 1e-14 AT5G64320 878 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.014G040200 72 / 5e-14 AT1G19290 883 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.017G071600 69 / 2e-13 AT5G40400 634 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G075900 67 / 9e-13 AT4G20090 806 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G074500 67 / 9e-13 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G035700 67 / 2e-12 AT1G05670 922 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Potri.003G204100 66 / 4e-12 AT1G07740 502 / 2e-176 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G368700 65 / 7e-12 AT5G55840 1272 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G234500 64 / 1e-11 AT1G74580 1034 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G154800 64 / 1e-11 AT4G20090 816 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10019080 pacid=23141818 polypeptide=Lus10019080 locus=Lus10019080.g ID=Lus10019080.BGIv1.0 annot-version=v1.0
ATGTATAAGCCGCTCATTCCAAAATGCTTTACGATCGTCAACGCTCCCCAAAACCCTCGTCTCTCCTTATTCCTATTCTCTTCTTCTTACTCCTCTCCTC
CCTCTTCGCCGCCTTCTGATCTCACATCCGCCATTCTCAACTCCAGAACCCCTGACCAAGCCCTCCAACTCTTCACCTCCGTCGTAAATCGCAACTCCAA
ATCCCCAGTGAAAAACCTTCCACATTTCTCCGCCGTGATTCACGTGTTAACCGGTGCTGGTGCGTACACGCCTGCCAGGTGCTTGATAAAAGGCCTGATC
CAGTCCTTCCTGAAATCCCACGACCCAAAACGTGCTAGCTCGTTGATTTTCGACGCTCTTAGTCGGCTGAAGAGCTCCAAATTCACTTCCGATGTGTTCG
GGACGTTGATTATTGCACTCTGTGAGGTGGGACTTGTTGATGAAGCCCTGTGGGTGCACCGCAAGATTGGTACTTTACCAGCGAGGCAAGCTTGTAATGC
CCTTATGAATGGGCTAGTTAAGAAAGGGAGATTCGAATCCATGTGGGAAACTTATGAAGAAATGATTTCCGGTGGGTTGGTGCCTAGTGTTGTCAGTTAT
GGCGTACTGATCAATGCTTGTTGCTGCCAAGGTGATCTAATAAAGGCGGCGGCTTTGATTAGCGAGATTATGGAGAAAGGGATTCAGCCCCACCGTTGTG
ATCTACACAACTCTCATTCGTGGGTTTTGCTGTGA
AA sequence
>Lus10019080 pacid=23141818 polypeptide=Lus10019080 locus=Lus10019080.g ID=Lus10019080.BGIv1.0 annot-version=v1.0
MYKPLIPKCFTIVNAPQNPRLSLFLFSSSYSSPPSSPPSDLTSAILNSRTPDQALQLFTSVVNRNSKSPVKNLPHFSAVIHVLTGAGAYTPARCLIKGLI
QSFLKSHDPKRASSLIFDALSRLKSSKFTSDVFGTLIIALCEVGLVDEALWVHRKIGTLPARQACNALMNGLVKKGRFESMWETYEEMISGGLVPSVVSY
GVLINACCCQGDLIKAAALISEIMEKGIQPHRCDLHNSHSWVLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G61400 Pentatricopeptide repeat (PPR)... Lus10019080 0 1
Lus10005528 4.1 0.8566
AT4G24200 Transcription elongation facto... Lus10009128 6.5 0.8336
AT2G18790 OOP1, HY3, PHYB OUT OF PHASE 1, phytochrome B ... Lus10016911 11.1 0.7897
AT3G27700 C3HZnF zinc finger (CCCH-type) family... Lus10032139 11.6 0.8462
AT5G16280 Tetratricopeptide repeat (TPR)... Lus10013588 14.6 0.8368
AT3G17900 unknown protein Lus10036712 18.0 0.8186
AT4G24680 MOS1 modifier of snc1 (.1) Lus10042094 19.2 0.8359
AT2G25320 TRAF-like family protein (.1) Lus10002926 23.5 0.8310
AT5G53150 DNAJ heat shock N-terminal dom... Lus10038816 24.0 0.8189
AT2G47330 P-loop containing nucleoside t... Lus10011466 25.0 0.8260

Lus10019080 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.