Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G61410 137 / 2e-41 RPE, EMB2728 EMBRYO DEFECTIVE 2728, D-ribulose-5-phosphate-3-epimerase (.1.2) AT3G01850 57 / 3e-11 Aldolase-type TIM barrel family protein (.1.2) AT1G63290 54 / 5e-10 Aldolase-type TIM barrel family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015715 [exp] 146 / 7e-45 AT5G61410 457 / 4e-164 EMBRYO DEFECTIVE 2728, D-ribulose-5-phosphate-3-epimerase (.1.2) Lus10021627 [exp] 144 / 3e-44 AT5G61410 452 / 2e-162 EMBRYO DEFECTIVE 2728, D-ribulose-5-phosphate-3-epimerase (.1.2) Lus10001653 [exp] 143 / 9e-44 AT5G61410 476 / 6e-172 EMBRYO DEFECTIVE 2728, D-ribulose-5-phosphate-3-epimerase (.1.2) Lus10035219 [exp] 49 / 4e-08 AT3G01850 372 / 6e-130 Aldolase-type TIM barrel family protein (.1.2) Lus10032052 [exp] 42 / 8e-06 AT1G63290 362 / 4e-128 Aldolase-type TIM barrel family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G062100 [exp] 141 / 3e-43 AT5G61410 494 / 4e-179 EMBRYO DEFECTIVE 2728, D-ribulose-5-phosphate-3-epimerase (.1.2) Potri.001G332700 [exp] 62 / 3e-13 AT3G01850 387 / 2e-138 Aldolase-type TIM barrel family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0036 [flax] [poplar] TIM_barrel PF00834 [flax] [poplar] Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Representative CDS sequence Show only first row Show all	>Lus10019082 pacid=23141776 polypeptide=Lus10019082 locus=Lus10019082.g ID=Lus10019082.BGIv1.0 annot-version=v1.0 ATGTCGGTGAACCCTGGTTTCGGTGGGCAGAGCTTCATAGAGAGCCAAGTAACCAAGATTGCCGATTTAAGAAGATTGTGTGTAGAAAAGGGAGTCAATC CATGGATAGAGGTCGACGGTGGTGTTGGTCCGAAAAATGCCTACAAGGTTATTGAGGCTGGAGGTAATGCCTTAGTTGCTGGCTCTGCTGTGTTCGGAGC AAAAGATTATGCAGAAGATAATACTGACAGCAGATATGCGGCATATAAGGCCCTTGATGTTAGTTGA
AA sequence Show only first row Show all	>Lus10019082 pacid=23141776 polypeptide=Lus10019082 locus=Lus10019082.g ID=Lus10019082.BGIv1.0 annot-version=v1.0 MSVNPGFGGQSFIESQVTKIADLRRLCVEKGVNPWIEVDGGVGPKNAYKVIEAGGNALVAGSAVFGAKDYAEDNTDSRYAAYKALDVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G61410		RPE, EMB2728	EMBRYO DEFECTIVE 2728, D-ribul...		Lus10019082 [exp]	0	1
AT5G56850			unknown protein		Lus10008560 [exp]	5.5	0.9104
AT5G16810			Protein kinase superfamily pro...		Lus10040743 [exp]	8.8	0.9206
AT2G32500			Stress responsive alpha-beta b...		Lus10015134 [exp]	12.5	0.8913
AT3G60370			FKBP-like peptidyl-prolyl cis-...		Lus10042897 [exp]	23.2	0.8995
					Lus10030090 [exp]	24.0	0.8934
AT3G47650			DnaJ/Hsp40 cysteine-rich domai...		Lus10005719 [exp]	26.7	0.8949
AT5G53850			haloacid dehalogenase-like hyd...		Lus10005542 [exp]	34.8	0.8797
AT4G02530			chloroplast thylakoid lumen pr...		Lus10030109 [exp]	35.5	0.8835
AT3G44890		RP19, RPL9	ribosomal protein L9 (.1)		Lus10041346 [exp]	36.5	0.8908
AT3G62910		APG3	ALBINO AND PALE GREEN, Peptide...		Lus10005944 [exp]	38.0	0.8807

Compare expression of checked genes

Lus10019082 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.