Lus10019084 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G26550 219 / 1e-74 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT2G18040 62 / 2e-13 PIN1AT "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1)
AT5G19370 48 / 4e-07 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015714 228 / 6e-78 AT1G26550 224 / 1e-76 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10014266 61 / 8e-13 AT2G18040 199 / 9e-68 "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1)
Lus10025967 62 / 2e-12 AT2G18040 200 / 8e-67 "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1)
Lus10000413 50 / 5e-08 AT5G19370 240 / 1e-77 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1)
Lus10026105 50 / 5e-08 AT5G19370 233 / 8e-76 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G089900 212 / 6e-72 AT1G26550 214 / 1e-72 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.007G013400 66 / 1e-14 AT2G18040 198 / 4e-67 "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1)
Potri.009G069300 50 / 1e-07 AT5G19370 281 / 3e-94 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0487 FKBP PF00639 Rotamase PPIC-type PPIASE domain
Representative CDS sequence
>Lus10019084 pacid=23141742 polypeptide=Lus10019084 locus=Lus10019084.g ID=Lus10019084.BGIv1.0 annot-version=v1.0
ATGGGGAAGAAAGATGGGGCAAAAGGCAAAGGTAAGGCAGCTAGTAGCAGCGATGAAAATGCTTCAAAGGGTAAGGGAAAAGCTGGAAAGGCCGATGGAC
TTGGCACATGCACATATGTAAAAGCAAGGCATATTTTATGTGAGAAGCAAGGTAAGATTAACGAGGCATACAAGAAACTGCAAGACGGTTGGCTAAGCAA
TGGAGATAAAGTTCCCCCCGCTGAGTTTGCGAAGGTAGCGACCGAGTATTCAGAATGCCCTTCGGGAAAGAAGGGAGGAGACCTTGGATGGTTTCCGCGT
GGGAAGATGGCCGGTCCGTTCCAGGAGGTTGCTTTCAACACCCCTGTTGGAGCTACTAGTGCACCGTTTAAGTCAACGCATGGGTATCACATAATCCTAT
CTGAAGGCAGAAAGAATTGA
AA sequence
>Lus10019084 pacid=23141742 polypeptide=Lus10019084 locus=Lus10019084.g ID=Lus10019084.BGIv1.0 annot-version=v1.0
MGKKDGAKGKGKAASSSDENASKGKGKAGKADGLGTCTYVKARHILCEKQGKINEAYKKLQDGWLSNGDKVPPAEFAKVATEYSECPSGKKGGDLGWFPR
GKMAGPFQEVAFNTPVGATSAPFKSTHGYHIILSEGRKN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G26550 FKBP-like peptidyl-prolyl cis-... Lus10019084 0 1
AT2G17350 unknown protein Lus10013847 2.8 0.8662
AT3G55920 Cyclophilin-like peptidyl-prol... Lus10030408 3.0 0.8861
AT2G31490 unknown protein Lus10027603 3.7 0.8507
AT4G35980 unknown protein Lus10041889 4.6 0.8670
AT1G56423 unknown protein Lus10029844 5.3 0.8701
AT4G26965 NADH:ubiquinone oxidoreductase... Lus10032642 5.5 0.8564
AT3G03070 NADH-ubiquinone oxidoreductase... Lus10039147 6.5 0.8605
AT5G08290 YLS8 YELLOW-LEAF-SPECIFIC GENE 8, m... Lus10010188 6.9 0.8627
AT3G45020 Ribosomal L18p/L5e family prot... Lus10021433 8.4 0.8654
AT3G15790 MBD11, ATMBD11 methyl-CPG-binding domain 11 (... Lus10043263 9.0 0.8573

Lus10019084 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.