Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48930 87 / 3e-21 HCT hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) AT5G57840 71 / 2e-15 HXXXD-type acyl-transferase family protein (.1) AT5G41040 60 / 2e-11 HXXXD-type acyl-transferase family protein (.1.2) AT5G63560 57 / 3e-10 HXXXD-type acyl-transferase family protein (.1) AT2G19070 53 / 4e-09 SHT spermidine hydroxycinnamoyl transferase (.1) AT3G48720 52 / 8e-09 DCF DEFICIENT IN CUTIN FERULATE, HXXXD-type acyl-transferase family protein (.1) AT1G28680 40 / 0.0001 HXXXD-type acyl-transferase family protein (.1) AT5G01210 39 / 0.0004 HXXXD-type acyl-transferase family protein (.1) AT1G27620 39 / 0.0006 HXXXD-type acyl-transferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022163 [exp] 154 / 6e-46 AT5G48930 449 / 2e-156 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Lus10010786 [exp] 154 / 6e-46 AT5G48930 451 / 5e-157 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Lus10037266 [exp] 118 / 2e-32 AT5G48930 365 / 4e-123 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Lus10026123 [exp] 98 / 5e-25 AT5G48930 597 / 0.0 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Lus10026097 [exp] 96 / 5e-24 AT5G48930 599 / 0.0 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Lus10002321 [exp] 95 / 7e-24 AT5G48930 639 / 0.0 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Lus10021394 [exp] 73 / 8e-16 AT2G19070 466 / 4e-162 spermidine hydroxycinnamoyl transferase (.1) Lus10005358 [exp] 71 / 3e-15 AT2G19070 471 / 2e-164 spermidine hydroxycinnamoyl transferase (.1) Lus10001282 [exp] 71 / 5e-15 AT2G19070 501 / 3e-175 spermidine hydroxycinnamoyl transferase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G104700 [exp] 125 / 6e-35 AT5G48930 489 / 5e-172 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Potri.018G105500 [exp] 113 / 2e-30 AT5G48930 556 / 0.0 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Potri.005G028100 [exp] 93 / 5e-23 AT5G48930 509 / 5e-180 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Potri.005G028000 [exp] 93 / 5e-23 AT5G48930 504 / 6e-178 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Potri.003G183900 [exp] 87 / 4e-21 AT5G48930 758 / 0.0 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Potri.001G042900 [exp] 84 / 5e-20 AT5G48930 749 / 0.0 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1) Potri.006G165200 [exp] 70 / 5e-15 AT2G19070 595 / 0.0 spermidine hydroxycinnamoyl transferase (.1) Potri.018G109900 [exp] 69 / 2e-14 AT2G19070 563 / 0.0 spermidine hydroxycinnamoyl transferase (.1) Potri.001G326300 [exp] 54 / 3e-09 AT5G41040 677 / 0.0 HXXXD-type acyl-transferase family protein (.1.2) Potri.015G100800 [exp] 53 / 5e-09 AT5G41040 644 / 0.0 HXXXD-type acyl-transferase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0149 [flax] [poplar] CoA-acyltrans PF02458 [flax] [poplar] Transferase Transferase family
Representative CDS sequence Show only first row Show all	>Lus10019105 pacid=23141810 polypeptide=Lus10019105 locus=Lus10019105.g ID=Lus10019105.BGIv1.0 annot-version=v1.0 ATGGTTGGGGATCTTGTTTTGGAGCCGATCGTTCGCACTCTAGATAGGATTCGAGAGAAGATCAAGAAGATGGATGATGAGAACCTAAGATCAGCAATTG ATTACTTGGAGAACCCTAATGACCCAACTAGCATGATGCAAGTCCCTGGGACTTCTCAGTCCCTAAACCTGAATATCATAAGCTGGATTAAACTTCCTTG CCACCGTGCTGATTTCGGGTTGGGGAGTCCGATCTTGATTCACCCTGCGAATCTGTTTGAAGGGAAAGGAAACCTCTTGCCGATGAGCGCAGATGGGAGC ATCTCCTTGATAATATGCTTGGAGGCCGATGCCATGGTGGAATTTCAGAAACTGGTTCAGAATGCTGGTAGTTGTTTATGA
AA sequence Show only first row Show all	>Lus10019105 pacid=23141810 polypeptide=Lus10019105 locus=Lus10019105.g ID=Lus10019105.BGIv1.0 annot-version=v1.0 MVGDLVLEPIVRTLDRIREKIKKMDDENLRSAIDYLENPNDPTSMMQVPGTSQSLNLNIISWIKLPCHRADFGLGSPILIHPANLFEGKGNLLPMSADGS ISLIICLEADAMVEFQKLVQNAGSCL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G48930		HCT	hydroxycinnamoyl-CoA shikimate...		Lus10019105 [exp]	0	1
AT5G48930		HCT	hydroxycinnamoyl-CoA shikimate...		Lus10019106 [exp]	1.0	0.9894
AT1G10640			Pectin lyase-like superfamily ...		Lus10030886 [exp]	1.4	0.9684
AT2G42800		AtRLP29	receptor like protein 29 (.1)		Lus10031383 [exp]	8.4	0.9535
AT5G60370			unknown protein		Lus10023342 [exp]	8.5	0.9468
AT3G06720		IMPA1, IMPA-1, ...	importin alpha isoform 1 (.1.2...		Lus10001534 [exp]	8.5	0.9516
					Lus10002045 [exp]	8.7	0.9680
AT4G38210		ATHEXPALPHA1.23...	EXPANSIN 20, expansin A20 (.1)		Lus10026566 [exp]	9.2	0.9612
AT1G71691			GDSL-like Lipase/Acylhydrolase...		Lus10001540 [exp]	9.8	0.9672
AT5G66440			unknown protein		Lus10025994 [exp]	14.1	0.9597
AT1G05490		CHR31	chromatin remodeling 31 (.1)		Lus10011033 [exp]	19.1	0.9158

Compare expression of checked genes

Lus10019105 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.