Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G10860 96 / 2e-28 Cytochrome b-c1 complex, subunit 8 protein (.1) AT5G05370 91 / 2e-26 Cytochrome b-c1 complex, subunit 8 protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034442 [exp] 118 / 5e-37 AT3G10860 115 / 6e-36 Cytochrome b-c1 complex, subunit 8 protein (.1) Lus10035013 [exp] 82 / 9e-23 AT5G05370 75 / 6e-20 Cytochrome b-c1 complex, subunit 8 protein (.1) Lus10021674 [exp] 80 / 3e-22 AT5G05370 75 / 3e-20 Cytochrome b-c1 complex, subunit 8 protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G159700 [exp] 99 / 2e-29 AT3G10860 120 / 8e-38 Cytochrome b-c1 complex, subunit 8 protein (.1) Potri.019G132000 [exp] 97 / 1e-28 AT5G05370 124 / 3e-39 Cytochrome b-c1 complex, subunit 8 protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0429 [flax] [poplar] UcrQ-like PF10890 [flax] [poplar] Cyt_b-c1_8 Cytochrome b-c1 complex subunit 8
Representative CDS sequence Show only first row Show all	>Lus10019118 pacid=23141712 polypeptide=Lus10019118 locus=Lus10019118.g ID=Lus10019118.BGIv1.0 annot-version=v1.0 ATGGGGAAGCAACCAGTGAGGATGAGAGCTGTGATTTACGCGCTCTCCCCTTTCCAGCAGAAGACTGTTTCAGGCCTCTTCAGGGATCTGCCTTCCAAGC TCCAGCACAAGGTTTCTGAGAATTGGCTCAGCGCCACCCTCCTCCTCACCCCTGTAGTCGGCGTCTACACGTAA
AA sequence Show only first row Show all	>Lus10019118 pacid=23141712 polypeptide=Lus10019118 locus=Lus10019118.g ID=Lus10019118.BGIv1.0 annot-version=v1.0 MGKQPVRMRAVIYALSPFQQKTVSGLFRDLPSKLQHKVSENWLSATLLLTPVVGVYT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G10860			Cytochrome b-c1 complex, subun...		Lus10019118 [exp]	0	1
AT3G48030			hypoxia-responsive family prot...		Lus10002358 [exp]	1.4	0.8671
AT3G47300		SELT	SELT-like protein precursor (....		Lus10001253 [exp]	2.4	0.8894
AT4G21105			cytochrome-c oxidases;electron...		Lus10006276 [exp]	4.5	0.8238
AT3G15140			Polynucleotidyl transferase, r...		Lus10005381 [exp]	5.9	0.8398
AT3G59280		TXR1	THAXTOMIN A RESISTANT 1, Prote...		Lus10032532 [exp]	6.9	0.8311
AT1G32330	HSF	ATHSFA1D	heat shock transcription facto...		Lus10040091 [exp]	8.5	0.8621
AT2G20140		RPT2b	regulatory particle AAA-ATPase...		Lus10019995 [exp]	9.2	0.8316
AT4G30010			unknown protein		Lus10015329 [exp]	10.8	0.8529
AT1G68140			Protein of unknown function (D...		Lus10020957 [exp]	12.3	0.8021
					Lus10036954 [exp]	17.4	0.8161

Compare expression of checked genes

Lus10019118 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.