Lus10019121 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G63250 155 / 2e-44 DEA(D/H)-box RNA helicase family protein (.1)
AT2G07750 154 / 3e-44 DEA(D/H)-box RNA helicase family protein (.1)
AT2G37920 82 / 9e-20 EMB1513 embryo defective 1513, copper ion transmembrane transporters (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034440 209 / 1e-70 AT1G63250 161 / 1e-46 DEA(D/H)-box RNA helicase family protein (.1)
Lus10002043 86 / 3e-20 AT2G37920 259 / 4e-84 embryo defective 1513, copper ion transmembrane transporters (.1)
Lus10024339 85 / 6e-20 AT2G37920 245 / 8e-79 embryo defective 1513, copper ion transmembrane transporters (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G107300 151 / 3e-43 AT1G63250 841 / 0.0 DEA(D/H)-box RNA helicase family protein (.1)
Potri.003G124100 134 / 4e-37 AT1G63250 883 / 0.0 DEA(D/H)-box RNA helicase family protein (.1)
Potri.006G092100 85 / 3e-20 AT2G37920 243 / 1e-79 embryo defective 1513, copper ion transmembrane transporters (.1)
Potri.016G103600 84 / 5e-20 AT2G37920 250 / 4e-82 embryo defective 1513, copper ion transmembrane transporters (.1)
PFAM info
Representative CDS sequence
>Lus10019121 pacid=23141808 polypeptide=Lus10019121 locus=Lus10019121.g ID=Lus10019121.BGIv1.0 annot-version=v1.0
ATGCAATTGGGCAGGGTTTCCGGTCTCCTCGGCAGCCGCCTCTTCGTCCGATTCATGGGCGGAGGGCCACGTACATTCCCCGGCGGCTTAAACAAGTGGC
AGTGGAAGCGTATGCACGAGAAGCAAGCTCGAGAGAAGGAAAAACGCCTCCTTGACCAGGAAAAGCAACTCTACCAAGCCAGAATACGATCCCAAATCCG
GTCCAAACTTGTCGATGGAGACCCCGATAGCATCGAATCCTCCTCCGGCTCTGCTGCTGCTTCCGGTGCCAATTATAACCCCATGACTCCCAAAGACCAC
GTCAAAGCTCTAGCTGATCGTTTCATGAAGGAAGGAGCTGAGGATTTGTGGAATGAGGATGATGGCCCTTTGCAAACCCCACTCCCAAGATCAGCTGAAC
GTTTTGAGATGACGAATCATGAACATCGGTTAATTTGA
AA sequence
>Lus10019121 pacid=23141808 polypeptide=Lus10019121 locus=Lus10019121.g ID=Lus10019121.BGIv1.0 annot-version=v1.0
MQLGRVSGLLGSRLFVRFMGGGPRTFPGGLNKWQWKRMHEKQAREKEKRLLDQEKQLYQARIRSQIRSKLVDGDPDSIESSSGSAAASGANYNPMTPKDH
VKALADRFMKEGAEDLWNEDDGPLQTPLPRSAERFEMTNHEHRLI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G63250 DEA(D/H)-box RNA helicase fami... Lus10019121 0 1
AT5G42520 BBR_BPC BPC6, BBR/BPC6,... ARABIDOPSIS THALIANA BASIC PEN... Lus10024313 2.6 0.7130
AT2G16940 Splicing factor, CC1-like (.1.... Lus10025075 10.2 0.5750
AT5G10990 SAUR-like auxin-responsive pro... Lus10026297 13.3 0.6089
AT3G04710 TPR10 tetratricopeptide repeat 10, a... Lus10006559 14.4 0.6582
AT1G12400 Nucleotide excision repair, TF... Lus10000383 22.9 0.6578
AT5G27240 DNAJ heat shock N-terminal dom... Lus10001726 28.0 0.6305
AT5G62950 RNA polymerase II, Rpb4, core ... Lus10005329 31.6 0.6141
AT4G20330 Transcription initiation facto... Lus10005100 33.3 0.6561
AT5G42520 BBR_BPC BPC6, BBR/BPC6,... ARABIDOPSIS THALIANA BASIC PEN... Lus10012389 45.9 0.5903
AT3G28455 CLE25 CLAVATA3/ESR-RELATED 25 (.1) Lus10005836 50.5 0.6098

Lus10019121 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.