Lus10019123 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G58260 204 / 2e-67 NdhN NADH dehydrogenase-like complex N, oxidoreductases, acting on NADH or NADPH, quinone or similar compound as acceptor (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034438 259 / 1e-88 AT5G58260 286 / 7e-99 NADH dehydrogenase-like complex N, oxidoreductases, acting on NADH or NADPH, quinone or similar compound as acceptor (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G160600 218 / 2e-72 AT5G58260 280 / 3e-96 NADH dehydrogenase-like complex N, oxidoreductases, acting on NADH or NADPH, quinone or similar compound as acceptor (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF11909 NdhN NADH-quinone oxidoreductase cyanobacterial subunit N
Representative CDS sequence
>Lus10019123 pacid=23141764 polypeptide=Lus10019123 locus=Lus10019123.g ID=Lus10019123.BGIv1.0 annot-version=v1.0
ATGTCGGACGTGGAAGAGCACAAATCCCTCGCCATTTATCCGCCTCACGAGGGAGGCTACGAAGGTCGCTACTTCACTAAGCTTAGATATGACGGCTACT
TCTTCCTCGATGTCTCAGCTCGTGGACTAGGCGACCCCGAGTCCACCCTCACCAAAGTCCATCCCGTTTGCCCCGCGAATTTGGGGAAGCAACCTATTGC
TCGGTGGTATTTCCCGCCGAAGGTTGATTATAGACTTGCTGTGCTTCCCTCCGATGCTAAAGGACTCGTCATCTGGGTCACCGAAGCCAAGGTTCTATCC
AAGGCAGAGCTGCAGTTCCTGGCATTGCTTCCAACCCTCCGCCCAAAGTCCGCGTCATTGCTGAATGCGGAAACTGGTAAAAAATTCATGATCATACCTC
TCTGTCTGATAGAAACTTTACCTGAGATTCATTCTTGTATGGTGTGTGGTGGTGATGTGTTCAGGAGGCAGTTTGTGTGGAAGCCGCTCAAAGAGATTGC
TGGACTAACCACTCAGACTGAGGTTGCCGCCTGA
AA sequence
>Lus10019123 pacid=23141764 polypeptide=Lus10019123 locus=Lus10019123.g ID=Lus10019123.BGIv1.0 annot-version=v1.0
MSDVEEHKSLAIYPPHEGGYEGRYFTKLRYDGYFFLDVSARGLGDPESTLTKVHPVCPANLGKQPIARWYFPPKVDYRLAVLPSDAKGLVIWVTEAKVLS
KAELQFLALLPTLRPKSASLLNAETGKKFMIIPLCLIETLPEIHSCMVCGGDVFRRQFVWKPLKEIAGLTTQTEVAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G58260 NdhN NADH dehydrogenase-like comple... Lus10019123 0 1
AT1G60230 Radical SAM superfamily protei... Lus10029159 3.5 0.8953
AT3G19340 Protein of unknown function (D... Lus10035127 4.0 0.8838
AT3G56160 Sodium Bile acid symporter fam... Lus10019540 5.3 0.8752
AT1G54680 unknown protein Lus10018965 5.8 0.8909
AT3G56160 Sodium Bile acid symporter fam... Lus10043384 6.3 0.8481
AT2G23390 unknown protein Lus10010689 7.7 0.8618
AT4G21380 ARK3 receptor kinase 3 (.1) Lus10037732 9.6 0.8385
AT1G29050 TBL38 TRICHOME BIREFRINGENCE-LIKE 38... Lus10024176 12.5 0.8578
AT5G19500 Tryptophan/tyrosine permease (... Lus10036099 13.7 0.8626
AT5G27290 unknown protein Lus10018966 15.3 0.8834

Lus10019123 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.