Lus10019135 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14730 157 / 1e-48 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT4G25570 91 / 2e-22 ACYB-2 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT5G38630 89 / 7e-22 ACYB-1 cytochrome B561-1 (.1)
AT1G26100 52 / 5e-08 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034427 232 / 9e-78 AT1G14730 280 / 4e-96 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10031935 203 / 2e-66 AT1G14730 284 / 8e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10027461 98 / 7e-25 AT4G25570 287 / 3e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10039216 97 / 1e-24 AT4G25570 305 / 6e-106 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10038866 86 / 2e-20 AT4G25570 326 / 3e-114 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10014986 83 / 4e-19 AT4G25570 331 / 8e-115 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10028996 82 / 4e-19 AT4G25570 145 / 4e-43 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10003682 78 / 2e-17 AT4G25570 131 / 1e-37 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10003076 57 / 4e-10 AT5G38630 281 / 2e-97 cytochrome B561-1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G102400 167 / 2e-52 AT1G14730 271 / 7e-93 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G138300 167 / 4e-52 AT1G14730 252 / 2e-85 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.015G143700 104 / 7e-28 AT4G25570 297 / 8e-103 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.012G141000 96 / 2e-24 AT4G25570 254 / 5e-86 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.004G103800 91 / 2e-22 AT5G38630 301 / 2e-104 cytochrome B561-1 (.1)
Potri.017G111700 86 / 2e-20 AT5G38630 321 / 2e-112 cytochrome B561-1 (.1)
Potri.008G115300 84 / 5e-20 AT5G38630 272 / 7e-93 cytochrome B561-1 (.1)
Potri.008G115200 53 / 1e-08 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.010G131100 52 / 4e-08 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Lus10019135 pacid=23141823 polypeptide=Lus10019135 locus=Lus10019135.g ID=Lus10019135.BGIv1.0 annot-version=v1.0
ATGGAGACGGGGGTGGTATATAGGAGGTCTGCATCTGGGCTGACGGTAGGTGCTCACGTGTTTGGGATACTGGGGATCATACTGATGCTGGTGTGGTTGC
TTCACTTCCGTGAAGGGATTGAGTATGATTCTGACAACCCGGCTCGCGTCTTCAATGTTCATCCATTCCTCATGTTCTGCGGATTCATCTTCCTCGTTGG
TCAAGCGATGATGGCATACAAGTCGGTGCCGGCGGCGAGAGAAGCACAGAAGGTAGTGCACATGGTCCTAAACCTGGTCGGAATAGCTGTAGGGATCGCC
GGAATATCGGCGGCGTTCAGGTTCCACGACATGGTGAACGCGGAGGATATGTACAGCCTCCATTCCTGGATAGGACTCACAACGTTTCTGTCTGGTGGGA
CTCCAGTGGCTCCTCGGATTCTTCACCTACATGTTCCCCAAGGCCAGCCAGGGGACGCGTGGCAGCATGATGGCGAGGCACATCAGCGGCGGCAGGACCC
TGCTGTACATGGCAATCTGCGCCGCCCTCACCGGAGTCATGGAGAAGTCCAGCATCCTGCGGCTCCAAGGATACGGCGAGGCTAG
AA sequence
>Lus10019135 pacid=23141823 polypeptide=Lus10019135 locus=Lus10019135.g ID=Lus10019135.BGIv1.0 annot-version=v1.0
METGVVYRRSASGLTVGAHVFGILGIILMLVWLLHFREGIEYDSDNPARVFNVHPFLMFCGFIFLVGQAMMAYKSVPAAREAQKVVHMVLNLVGIAVGIA
GISAAFRFHDMVNAEDMYSLHSWIGLTTFLSGGTPVAPRILHLHVPQGQPGDAWQHDGEAHQRRQDPAVHGNLRRPHRSHGEVQHPAAPRIRRG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G14730 Cytochrome b561/ferric reducta... Lus10019135 0 1
AT1G23530 unknown protein Lus10030608 1.7 0.9739
AT5G46530 AWPM-19-like family protein (.... Lus10004587 2.0 0.9650
AT5G18970 AWPM-19-like family protein (.... Lus10001116 3.0 0.9605
AT1G75720 Plant protein of unknown funct... Lus10024335 3.5 0.9508
AT5G67550 unknown protein Lus10011544 3.9 0.9588
AT5G04890 RTM2 RESTRICTED TEV MOVEMENT 2, HSP... Lus10028874 4.9 0.9604
AT5G24620 Pathogenesis-related thaumatin... Lus10032914 6.9 0.9562
AT1G14730 Cytochrome b561/ferric reducta... Lus10031935 9.4 0.9516
AT1G60360 RING/U-box superfamily protein... Lus10022967 9.5 0.9517
AT1G75260 oxidoreductases, acting on NAD... Lus10033210 9.9 0.9557

Lus10019135 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.