Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02050 163 / 5e-54 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034424 [exp] 212 / 3e-73 AT2G02050 162 / 3e-53 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1) Lus10031932 [exp] 210 / 1e-71 AT2G02050 164 / 4e-53 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1) Lus10035094 [exp] 208 / 1e-71 AT2G02050 161 / 4e-53 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G099900 [exp] 178 / 6e-60 AT2G02050 159 / 2e-52 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1) Potri.008G141900 [exp] 176 / 7e-59 AT2G02050 159 / 3e-52 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0351 [flax] [poplar] CHCH PF05676 [flax] [poplar] NDUF_B7 NADH-ubiquinone oxidoreductase B18 subunit (NDUFB7)
Representative CDS sequence Show only first row Show all	>Lus10019137 pacid=23141747 polypeptide=Lus10019137 locus=Lus10019137.g ID=Lus10019137.BGIv1.0 annot-version=v1.0 ATGGAAGTGCCGGGATCATCGAAGCCCATGATTGCCACCCAGGCGGAGATGGTGGAAGCGAGAGTCCCCATGGCTTACAGAGACCAGTGCGCCCATCTCC TCATCCCGCTCAACAAGTGCCGCCAGTCCGAGTTCTACCTGCCATGGAAGTGCGAGGACGAGCGCCATTCCTATGAGAAGTGCGAGTACGAGCTTGTCAT GGAGAGGATGCTCCAGATGCAGAAGATCCGCGAAGAGGAGGCCAAGCTCAAACACCCGAACAAACAAGGAGGTGCTGCTATCGGTCTCATCCCCAAGACT GCCAATGCCTAG
AA sequence Show only first row Show all	>Lus10019137 pacid=23141747 polypeptide=Lus10019137 locus=Lus10019137.g ID=Lus10019137.BGIv1.0 annot-version=v1.0 MEVPGSSKPMIATQAEMVEARVPMAYRDQCAHLLIPLNKCRQSEFYLPWKCEDERHSYEKCEYELVMERMLQMQKIREEEAKLKHPNKQGGAAIGLIPKT ANA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02050			NADH-ubiquinone oxidoreductase...		Lus10019137 [exp]	0	1
AT5G13450		ATP5	delta subunit of Mt ATP syntha...		Lus10019706 [exp]	1.7	0.9470
AT5G40490			RNA-binding (RRM/RBD/RNP motif...		Lus10014562 [exp]	2.0	0.9436
AT2G42210		ATOEP16-3	Mitochondrial import inner mem...		Lus10012024 [exp]	2.4	0.9413
AT5G52840			NADH-ubiquinone oxidoreductase...		Lus10027539 [exp]	3.9	0.9342
AT1G54140		TAF9, TAFII21	TBP-ASSOCIATED FACTOR 9, TATA ...		Lus10012411 [exp]	5.3	0.9273
AT5G47030			ATPase, F1 complex, delta/epsi...		Lus10040130 [exp]	5.7	0.9235
AT5G47030			ATPase, F1 complex, delta/epsi...		Lus10001082 [exp]	6.6	0.9344
AT3G52300		ATPQ	"ATP synthase D chain, mitocho...		Lus10038474 [exp]	7.7	0.9231
AT2G20820			unknown protein		Lus10031625 [exp]	9.5	0.9241
AT3G54200			Late embryogenesis abundant (L...		Lus10018185 [exp]	10.1	0.8853

Compare expression of checked genes

Lus10019137 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.