Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18150 75 / 3e-19 Methyltransferase-related protein (.1) AT5G14602 64 / 6e-15 unknown protein AT5G58375 61 / 6e-14 Methyltransferase-related protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034423 [exp] 141 / 3e-45 AT5G18150 87 / 5e-24 Methyltransferase-related protein (.1) Lus10020287 [exp] 87 / 4e-24 AT5G18150 109 / 4e-33 Methyltransferase-related protein (.1) Lus10005698 [exp] 86 / 3e-23 AT5G18150 108 / 1e-32 Methyltransferase-related protein (.1) Lus10008585 [exp] 57 / 4e-12 AT5G58375 89 / 1e-24 Methyltransferase-related protein (.1) Lus10042227 [exp] 56 / 1e-11 AT5G58375 91 / 2e-25 Methyltransferase-related protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G058200 [exp] 83 / 2e-22 AT5G18150 114 / 5e-35 Methyltransferase-related protein (.1) Potri.019G035000 [exp] 77 / 6e-20 AT5G18150 109 / 4e-33 Methyltransferase-related protein (.1) Potri.013G155800 [exp] 64 / 1e-14 AT5G58375 67 / 5e-16 Methyltransferase-related protein (.1) Potri.019G127900 [exp] 51 / 1e-09 AT5G58375 64 / 6e-15 Methyltransferase-related protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019138 pacid=23141804 polypeptide=Lus10019138 locus=Lus10019138.g ID=Lus10019138.BGIv1.0 annot-version=v1.0 ATGTGTCCTATGAGGTTGATCTTGGTGTTCTTCTCGGCGGTTTTGGCCGGCTATTTTGCCTGGACGACCGCGACGACGACGGCTTCTCCCGCAGACAATT CGACGATTGACAAGTCTGATATGTTCAAGAGGCAGAAGGAGGAATCCAATACGACCAAAGTCAATTGCTTCTTTCCCTCTGTTTCTCTGCAGGGGATTCA GAGTTGGTTCTGGGTATTTGTGGACATGGCGAGCGGGAGATACTTGTGGAGGAACCTCAATGGAATCAAGATACAACAGAAGAGTTAG
AA sequence Show only first row Show all	>Lus10019138 pacid=23141804 polypeptide=Lus10019138 locus=Lus10019138.g ID=Lus10019138.BGIv1.0 annot-version=v1.0 MCPMRLILVFFSAVLAGYFAWTTATTTASPADNSTIDKSDMFKRQKEESNTTKVNCFFPSVSLQGIQSWFWVFVDMASGRYLWRNLNGIKIQQKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G18150			Methyltransferase-related prot...		Lus10019138 [exp]	0	1
AT3G55430			O-Glycosyl hydrolases family 1...		Lus10040294 [exp]	2.8	0.8870
AT1G80840	WRKY	ATWRKY40, WRKY4...	WRKY DNA-binding protein 40 (....		Lus10026082 [exp]	3.5	0.8897
AT1G77480			Eukaryotic aspartyl protease f...		Lus10025687 [exp]	5.3	0.8573
AT1G74950	ZIM	TIFY10B, JAZ2	JASMONATE-ZIM-DOMAIN PROTEIN 2...		Lus10013166 [exp]	5.5	0.8583
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10020773 [exp]	9.5	0.8406
AT2G02960			RING/FYVE/PHD zinc finger supe...		Lus10012826 [exp]	11.8	0.8194
AT4G17500	AP2_ERF	ATERF-1, AtERF1	ethylene responsive element bi...		Lus10004368 [exp]	12.0	0.8252
AT2G26640		KCS11	3-ketoacyl-CoA synthase 11 (.1...		Lus10019448 [exp]	12.2	0.8275
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Lus10031484 [exp]	14.7	0.8349
AT1G18210			Calcium-binding EF-hand family...		Lus10031345 [exp]	15.5	0.8528

Compare expression of checked genes

Lus10019138 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.