Lus10019150 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G04240 60 / 7e-12 XERICO RING/U-box superfamily protein (.1.2)
AT1G15100 59 / 2e-11 RHA2A RING-H2 finger A2A (.1)
AT1G67856 56 / 2e-10 RING/U-box superfamily protein (.1)
AT2G01150 55 / 4e-10 RHA2B RING-H2 finger protein 2B (.1)
AT3G61460 54 / 9e-10 BRH1 brassinosteroid-responsive RING-H2 (.1)
AT1G63840 53 / 2e-09 RING/U-box superfamily protein (.1)
AT5G41400 52 / 9e-09 RING/U-box superfamily protein (.1)
AT3G62690 52 / 9e-09 ATL5 AtL5 (.1)
AT4G38140 51 / 9e-09 RING/U-box superfamily protein (.1)
AT3G51325 49 / 1e-08 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034407 186 / 6e-62 AT2G04240 61 / 2e-12 RING/U-box superfamily protein (.1.2)
Lus10007936 58 / 2e-11 AT2G01150 104 / 3e-29 RING-H2 finger protein 2B (.1)
Lus10013475 57 / 8e-11 AT2G01150 104 / 2e-29 RING-H2 finger protein 2B (.1)
Lus10032290 56 / 2e-10 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10024657 56 / 3e-10 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10008283 56 / 3e-10 AT3G61460 77 / 5e-18 brassinosteroid-responsive RING-H2 (.1)
Lus10017510 53 / 3e-09 AT3G61460 176 / 6e-57 brassinosteroid-responsive RING-H2 (.1)
Lus10036378 53 / 5e-09 AT3G61460 210 / 5e-70 brassinosteroid-responsive RING-H2 (.1)
Lus10028773 52 / 5e-09 AT3G61460 169 / 4e-54 brassinosteroid-responsive RING-H2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G133300 69 / 1e-15 AT3G61460 69 / 2e-15 brassinosteroid-responsive RING-H2 (.1)
Potri.010G133200 69 / 1e-15 AT3G61460 69 / 3e-15 brassinosteroid-responsive RING-H2 (.1)
Potri.010G047100 66 / 3e-14 AT1G67856 133 / 4e-41 RING/U-box superfamily protein (.1)
Potri.007G086200 62 / 8e-13 AT1G15100 74 / 5e-17 RING-H2 finger A2A (.1)
Potri.010G133700 61 / 9e-13 AT3G61460 66 / 4e-14 brassinosteroid-responsive RING-H2 (.1)
Potri.008G185800 61 / 1e-12 AT1G67856 127 / 2e-38 RING/U-box superfamily protein (.1)
Potri.005G081300 61 / 4e-12 AT2G01150 75 / 1e-17 RING-H2 finger protein 2B (.1)
Potri.007G086300 60 / 7e-12 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1)
Potri.007G086100 59 / 1e-11 AT2G01150 71 / 3e-16 RING-H2 finger protein 2B (.1)
Potri.014G170400 56 / 1e-10 AT2G04240 181 / 3e-59 RING/U-box superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10019150 pacid=23141768 polypeptide=Lus10019150 locus=Lus10019150.g ID=Lus10019150.BGIv1.0 annot-version=v1.0
ATGTCGAAATTCTTCAATCTGATCTCCACCCAACTCCAACAGGTTCTGGAATTCTTGAATTCCAATCCCAGACAGCTCGGAAGAAATTCCGAAATGGGAA
AACAGAGTTCATCTGGCCTCTGCCACTACTGCTACTACAGCGGCGGCAGCAACAACTCAGAATTACAAGACTGCTCAATCTGTCTGGCCAAGATCCAGCA
ACGGGAACAAGTTACCAAATTGAGGTGCACCCATTTGTTCCACAGAGCTTGCTTGGACCGATGGTTCGGATCATCCGGCTTGACTTGCCCCCTTTGCCGG
GACAACTTGGCTCTCACCGCTGCCGCCGCCGACGGCGGAGGAGTTCATGTCTTGGAGCTGCGGTTCGTGAGTGCTACTAGTTTGCGATCCTCGGACGACC
GGGACTCCCTTTGGTTACGATGA
AA sequence
>Lus10019150 pacid=23141768 polypeptide=Lus10019150 locus=Lus10019150.g ID=Lus10019150.BGIv1.0 annot-version=v1.0
MSKFFNLISTQLQQVLEFLNSNPRQLGRNSEMGKQSSSGLCHYCYYSGGSNNSELQDCSICLAKIQQREQVTKLRCTHLFHRACLDRWFGSSGLTCPLCR
DNLALTAAAADGGGVHVLELRFVSATSLRSSDDRDSLWLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G04240 XERICO RING/U-box superfamily protein... Lus10019150 0 1
AT3G55370 DOF OBP3, AtDof3. 6 OBF-binding protein 3 (.1.2.3) Lus10036172 7.3 0.8773
AT5G56350 Pyruvate kinase family protein... Lus10013396 11.2 0.8668
AT1G49310 unknown protein Lus10040476 30.9 0.8697
AT3G15210 AP2_ERF ATERF4, RAP2.5... RELATED TO AP2 5, ethylene res... Lus10033664 36.0 0.8377
AT4G20820 FAD-binding Berberine family p... Lus10032943 47.2 0.8533
AT4G27270 Quinone reductase family prote... Lus10006748 56.4 0.8342
AT3G25250 AtOXI1, OXI1, A... oxidative signal-inducible1, A... Lus10025882 56.5 0.8515
AT4G19460 UDP-Glycosyltransferase superf... Lus10034760 57.7 0.8251
AT2G15220 Plant basic secretory protein ... Lus10019806 70.3 0.8362
AT3G22060 Receptor-like protein kinase-r... Lus10027145 71.2 0.7967

Lus10019150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.