Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68730 118 / 3e-35 Zim17-type zinc finger protein (.1) AT5G27280 74 / 1e-17 Zim17-type zinc finger protein (.1) AT3G54826 52 / 4e-09 Zim17-type zinc finger protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034401 [exp] 169 / 4e-55 AT1G68730 130 / 1e-38 Zim17-type zinc finger protein (.1) Lus10021838 [exp] 72 / 9e-17 AT5G27280 216 / 3e-71 Zim17-type zinc finger protein (.1) Lus10034555 [exp] 72 / 9e-17 AT5G27280 216 / 2e-71 Zim17-type zinc finger protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G132400 [exp] 140 / 5e-44 AT1G68730 139 / 1e-42 Zim17-type zinc finger protein (.1) Potri.005G246200 [exp] 73 / 6e-17 AT5G27280 225 / 5e-75 Zim17-type zinc finger protein (.1) Potri.002G015900 [exp] 72 / 7e-17 AT5G27280 219 / 2e-72 Zim17-type zinc finger protein (.1) Potri.008G037300 [exp] 54 / 7e-10 AT3G54826 173 / 2e-54 Zim17-type zinc finger protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05180 [flax] [poplar] zf-DNL DNL zinc finger
Representative CDS sequence Show only first row Show all	>Lus10019154 pacid=23141761 polypeptide=Lus10019154 locus=Lus10019154.g ID=Lus10019154.BGIv1.0 annot-version=v1.0 ATGGGAGTTCGAACCCATTCCGACGGGAGTGCAACAATAGACATAAACTTGCCAAGGAGGAGTTTACTTGTGCAGTTTACTTGCAATGATTGTGGTGAAA GAACACTAAGACTCGTAAATCGTTTGGCCTATGAGCGGGGGCTCGTCTTTGTACAGTGTGCAGGATGCGAGAAGTATCATAAACTAGTTGATAATCTTGG TCTCATAGTCGAATATGATTTGCGGGAGGAGATTCCAACCAAACCAAATGCAGATAAAGATCCATGCCCCAAGAAATTCGAATATTACTGTGTACTTGCA GTCTGA
AA sequence Show only first row Show all	>Lus10019154 pacid=23141761 polypeptide=Lus10019154 locus=Lus10019154.g ID=Lus10019154.BGIv1.0 annot-version=v1.0 MGVRTHSDGSATIDINLPRRSLLVQFTCNDCGERTLRLVNRLAYERGLVFVQCAGCEKYHKLVDNLGLIVEYDLREEIPTKPNADKDPCPKKFEYYCVLA V

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G68730			Zim17-type zinc finger protein...		Lus10019154 [exp]	0	1
AT3G61620		RRP41	3'-5'-exoribonuclease family p...		Lus10005148 [exp]	3.0	0.8379
AT5G51140			Pseudouridine synthase family ...		Lus10022437 [exp]	3.7	0.8778
AT3G54900		ATGRXCP, CXIP1	GLUTAREDOXIN, CAX interacting ...		Lus10041501 [exp]	3.7	0.8184
AT1G12410		EMB3146, CLP2, ...	NUCLEAR-ENCODED CLP PROTEASE P...		Lus10028905 [exp]	3.9	0.8707
AT3G53730			Histone superfamily protein (....		Lus10005896 [exp]	3.9	0.8904
AT1G19100			Histidine kinase-, DNA gyrase ...		Lus10042100 [exp]	5.3	0.8617
AT2G45490		ATAUR3	ataurora3 (.1)		Lus10006266 [exp]	8.7	0.8582
AT3G48210			unknown protein		Lus10042089 [exp]	8.8	0.8529
AT4G16720			Ribosomal protein L23/L15e fam...		Lus10009653 [exp]	16.9	0.8459
AT1G16510			SAUR-like auxin-responsive pro...		Lus10040643 [exp]	19.1	0.7631

Compare expression of checked genes

Lus10019154 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.