Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G49550 102 / 1e-29 BLOS2 BLOC subunit 2, unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034392 [exp] 170 / 2e-56 AT5G49550 149 / 2e-47 BLOC subunit 2, unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G106200 [exp] 108 / 7e-32 AT5G49550 155 / 9e-50 BLOC subunit 2, unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10046 [flax] [poplar] BLOC1_2 Biogenesis of lysosome-related organelles complex-1 subunit 2
Representative CDS sequence Show only first row Show all	>Lus10019163 pacid=23141816 polypeptide=Lus10019163 locus=Lus10019163.g ID=Lus10019163.BGIv1.0 annot-version=v1.0 ATGGCAAGTGGAAGGGAGGAACAACAAGAAGTGAATGATGAGCTTGCTGACTCCATAAACGATCTCTTCATTAGCATCACATCAATGGTGAAGGGAGAGC TTCAGGGCACAAATAATGTATTGGCGCTTCTGGATAAGATGAACTTAAGAGTGGCTGAAGAGTATAGCAGCTTCGGCGATGTAGCTTCAGGGCTAACAGC GTTCGTTGAGCAGTTGAAGTCGAAAAGTGGTAGCTCCGATGAGTATGTAGAACAAATCGATGCGATGAACAGCAGGTTACCGAGTTTGAAGCTGTGA
AA sequence Show only first row Show all	>Lus10019163 pacid=23141816 polypeptide=Lus10019163 locus=Lus10019163.g ID=Lus10019163.BGIv1.0 annot-version=v1.0 MASGREEQQEVNDELADSINDLFISITSMVKGELQGTNNVLALLDKMNLRVAEEYSSFGDVASGLTAFVEQLKSKSGSSDEYVEQIDAMNSRLPSLKL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G49550		BLOS2	BLOC subunit 2, unknown protei...		Lus10019163 [exp]	0	1
AT3G13845			unknown protein		Lus10015617 [exp]	1.0	0.8171
AT2G32520			alpha/beta-Hydrolases superfam...		Lus10035287 [exp]	3.9	0.7968
AT1G47820			unknown protein		Lus10035088 [exp]	4.5	0.8049
AT5G47630		MTACP3	mitochondrial acyl carrier pro...		Lus10038782 [exp]	6.2	0.7540
AT3G06050		PRXIIF, ATPRXII...	peroxiredoxin IIF (.1)		Lus10041218 [exp]	7.1	0.7856
AT5G59613			unknown protein		Lus10040848 [exp]	8.4	0.7259
AT5G64350		FKP12, ATFKBP12...	ARABIDOPSIS THALIANA FK506-BIN...		Lus10016586 [exp]	11.7	0.7815
AT3G58090			Disease resistance-responsive ...		Lus10009074 [exp]	14.1	0.7778
AT3G50830		ATCOR413-PM2, C...	cold-regulated 413-plasma memb...		Lus10023833 [exp]	14.7	0.7797
AT1G35430			unknown protein		Lus10001289 [exp]	17.3	0.7448

Compare expression of checked genes

Lus10019163 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.