Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003696 [exp] 57 / 1e-10 AT3G51530 52 / 1e-07 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10028940 [exp] 51 / 9e-09 ND / Lus10001581 [exp] 50 / 3e-08 AT4G21120 915 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Lus10028939 [exp] 47 / 6e-07 AT3G29170 80 / 3e-18 Eukaryotic protein of unknown function (DUF872) (.1) Lus10036905 [exp] 44 / 3e-06 AT5G22660 54 / 1e-08 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1.2) Lus10034290 [exp] 44 / 6e-06 AT5G02910 53 / 2e-07 F-box/RNI-like superfamily protein (.1.2) Lus10029003 [exp] 41 / 7e-05 AT3G49030 57 / 3e-08 FBD, F-box and Leucine Rich Repeat domains containing protein (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019167 pacid=23141763 polypeptide=Lus10019167 locus=Lus10019167.g ID=Lus10019167.BGIv1.0 annot-version=v1.0 ATGCCCGCAATAGAGGTGAAAAAGTTGGATTTGAGTCGACGTTCTCGTCTAAAGGTCCAACATTTACTAATGGGAGTTGATTCCCTTTATTCTTTCGAGA CGGTTGATGAAGCTCAATTTTTTGATGCGGTCTTGTCGACATTCCGTCCAAAGAAGTTATCCATAGCTCAATCAAGTGACAACACAAGCTTATACTCTGA AGAAGATGAAGAAGAAGAAGGAAGTAATCGTCGACAGAATCTCAGAGCTACCGGACCAAATCATCCACATCATCGTTTGAAGCTTACCATCCCATCGGGA GGCGGCGAGAACCAGCATCTTGTCCAGAAGATGGCTCAACTTATGGCTCTCTAA
AA sequence Show only first row Show all	>Lus10019167 pacid=23141763 polypeptide=Lus10019167 locus=Lus10019167.g ID=Lus10019167.BGIv1.0 annot-version=v1.0 MPAIEVKKLDLSRRSRLKVQHLLMGVDSLYSFETVDEAQFFDAVLSTFRPKKLSIAQSSDNTSLYSEEDEEEEGSNRRQNLRATGPNHPHHRLKLTIPSG GGENQHLVQKMAQLMAL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10019167 [exp]	0	1
AT5G22450			unknown protein		Lus10000530 [exp]	5.0	1.0000
AT4G17220		ATMAP70-5	microtubule-associated protein...		Lus10003908 [exp]	7.1	1.0000
					Lus10011425 [exp]	9.6	1.0000
AT3G02100			UDP-Glycosyltransferase superf...		Lus10015750 [exp]	10.0	1.0000
AT4G13090		XTH2	xyloglucan endotransglucosylas...		Lus10032879 [exp]	12.2	1.0000
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Lus10031524 [exp]	12.4	1.0000
					Lus10007184 [exp]	13.2	1.0000
					Lus10007226 [exp]	14.1	1.0000
AT2G28605			Photosystem II reaction center...		Lus10009159 [exp]	15.0	1.0000
AT4G05120		FUR1, ENT3, FLU...	FUDR RESISTANT 1, EQUILIBRATIV...		Lus10018414 [exp]	16.6	1.0000

Compare expression of checked genes

Lus10019167 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.